KEGG   Sulfurisphaera tokodaii: STK_19040
Entry
STK_19040         CDS       T00062                                 

Definition
(GenBank) transposase for insertion sequence element
  KO
K07491  putative transposase
Organism
sto  Sulfurisphaera tokodaii
Brite
KEGG Orthology (KO) [BR:sto00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99976 Replication and repair
    STK_19040
SSDB
Motif
Pfam: Y1_Tnp BRCT DUF3105
Other DBs
NCBI-ProteinID: BAB66997
UniProt: Q96ZC8
Position
1907787..1908197
AA seq 136 aa
MEYKSTRHVKYLCNYHFIWIPKYRRKVLTGEVAEYTKEVLRTIAEELGCEVLALEVMPDH
IHLFVNCPPRYAPSYLANYFKGKSARLILKKFPELKKATNGKLWTRSYFVSTAGNVSSET
IKKYIEEQWAKESEED
NT seq 411 nt   +upstreamnt  +downstreamnt
gtggaatacaaatcaactaggcatgtaaagtacctctgcaactaccacttcatatggata
ccaaaatatcgtaggaaagtactaacaggtgaagttgctgaatacactaaagaggtatta
agaaccatagcagaagagttgggctgtgaagtattagccctagaagtaatgccagaccat
atccacctcttcgttaactgcccaccgagatacgcaccgtcatatttagcaaactacttc
aaaggaaaatcagcaagactaatcctcaagaagttcccagagctgaagaaagctactaac
gggaagctctggactagaagctacttcgtatctaccgcaggtaacgtatccagcgagacg
ataaagaagtacattgaagaacagtgggcgaaagagagtgaagaggactaa

DBGET integrated database retrieval system