KEGG   Sulfurisphaera tokodaii: STK_19560
Entry
STK_19560         CDS       T00062                                 
Name
(GenBank) putative carbamoyltransferase
  KO
K00612  carbamoyltransferase [EC:2.1.3.-]
Organism
sto  Sulfurisphaera tokodaii
Brite
KEGG Orthology (KO) [BR:sto00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    STK_19560
SSDB
Motif
Pfam: Carbam_trans_C Carbam_trans_N Sua5_yciO_yrdC
Other DBs
NCBI-ProteinID: BAB67050
UniProt: Q96Z76
Position
complement(1963215..1964729)
AA seq 504 aa
MKISVMHGLVGVTELHNYIWSYLRGDFLPLAKRVITKAILESHETIPSEIKIFSVPHHLA
HAASAYYFSGFNSATVITLDGSGEYEATVIWKVKDGEFEKILSMYSSYGSLGFLYEAMMV
GISFERLEGPGKGMGLAPYGKKSLYYDRLRSFVNINSDDGIPFYISDDKVIRRRKYYEII
YQAIYSKIAEKVIGGKLKWDPRGELNQDAVNIAWAVQKVTEEAVLATAKWAKDHTGEDKV
ALAGGVALNAKANMELHYAKIFNDMFIFPAANDAGGPIGAAAYVYEHVLGGKMKRQRLKN
VYLGPEYDDDVIKKVVQDSKFKAKYVGDDVNAVADLVAKGYIVTWYQGRAELGPRALGNR
SIVADPTRKEYWRLVNDIKGREWWRPLAPSLLDEDKGTYFKDPVSHEFMILMLRYKDEEV
CKRVPVTCHVDLTARPQTVTRDQNKTWYDLIKAFKDIKGEGLIMNTSFNLAGEPLVETPQ
DAMRSFALKGFDAMYMQGWLIYKR
NT seq 1515 nt   +upstreamnt  +downstreamnt
atgaagatatcagtgatgcatgggctggtaggagttacagagttacataattatatatgg
agttacttaagaggagatttcttaccattagccaaaagagttattacaaaagctatttta
gaatctcatgaaacaataccgtcagaaataaaaattttttctgtgcctcatcatttagct
catgcagcctcagcgtattatttttctggctttaactctgctactgtaatcactttagat
ggttcaggtgagtacgaggctactgttatatggaaggtaaaagatggagaattcgagaaa
attttatctatgtactcctcttatggttcattaggatttctttatgaggctatgatggta
gggatatcttttgaaagactggaaggtcctggaaaaggaatgggattagcaccttacggt
aaaaagtctctatattatgatagattaagatcgttcgttaatattaattcagatgatggc
atcccattttacatttcagatgataaagttataagaagaagaaaatattatgagattata
tatcaagctatctatagtaaaatagctgaaaaggttataggtggtaaacttaagtgggat
ccccgtggtgagttgaatcaagatgcagtaaacattgcttgggctgttcaaaaagtaact
gaggaggctgttttagctactgcaaagtgggcaaaagatcacacgggtgaggataaagtt
gccttagctggaggagtagctttaaatgctaaggctaatatggagttgcattacgccaag
atcttcaatgatatgtttatttttccagctgctaatgacgctggtgggccaataggtgct
gcagcttacgtttatgagcatgtgttgggaggcaaaatgaagagacaaaggctgaagaac
gtttacctagggccggaatatgacgatgatgtgattaagaaggttgttcaagatagtaag
tttaaggctaagtatgttggtgatgatgttaatgctgttgctgacttagttgctaagggt
tatattgtaacttggtatcaaggtagggctgagttgggccctagggcactcggtaatcgt
tcgattgttgctgacccgactaggaaggagtactggaggctggtcaacgatattaagggt
agggagtggtggaggccattagcaccgtctttgctagatgaggacaaaggcacttacttt
aaagatcccgtttcccacgagttcatgatactgatgctacgttataaggatgaggaggtg
tgtaagcgtgttccggtcacttgtcatgttgatttgactgctaggccacagactgtaact
agggatcagaataagacttggtatgatttgattaaggcgttcaaggatattaagggtgag
gggctaataatgaatacctcatttaacctcgccggtgaaccattagttgagacaccacag
gacgccatgaggagcttcgctttaaaaggttttgatgcaatgtatatgcaaggatggtta
atatataagaggtga

DBGET integrated database retrieval system