KEGG   Sulfurisphaera tokodaii: STK_19720
Entry
STK_19720         CDS       T00062                                 
Symbol
rfbB
Name
(GenBank) dTDP-glucose 4,6-dehydratase
  KO
K01710  dTDP-glucose 4,6-dehydratase [EC:4.2.1.46]
Organism
sto  Sulfurisphaera tokodaii
Pathway
sto00521  Streptomycin biosynthesis
sto00523  Polyketide sugar unit biosynthesis
sto00525  Acarbose and validamycin biosynthesis
sto01100  Metabolic pathways
sto01110  Biosynthesis of secondary metabolites
sto01250  Biosynthesis of nucleotide sugars
Module
sto_M00793  dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:sto00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    STK_19720 (rfbB)
   01055 Biosynthesis of vancomycin group antibiotics
    STK_19720 (rfbB)
  09110 Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    STK_19720 (rfbB)
   00525 Acarbose and validamycin biosynthesis
    STK_19720 (rfbB)
Enzymes [BR:sto01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.46  dTDP-glucose 4,6-dehydratase
     STK_19720 (rfbB)
SSDB
Motif
Pfam: Epimerase GDP_Man_Dehyd RmlD_sub_bind 3Beta_HSD Polysacc_synt_2 NAD_binding_4 adh_short NmrA
Other DBs
NCBI-ProteinID: BAB67067
UniProt: Q96Z59
Position
1982492..1983454
AA seq 320 aa
MIIIGGAGFIGSAFVREVNRRGIKPVVIDLLTYAGRMENLIGTNHDFVRADIRSEEIHNI
LKEKESASNVVVNFAAETHVDRSIYKPQDFVTTNVIGVVNLLEAARKYDFNYVHISTDEV
YGEECGDEDSPLKPSSPYSASKASADLFVKAYVRTYGIKAIIIRPSNNYGPRQFPEKLIP
KVIIRTLMGEYVPIYGDGRAERDWIYVEDTARIIYDILEMAEWRGEVYNIPGGQRYSVLD
VVKMIGEVMGREVKIKFVSDRPGHDRRYCMITKLKYEVTPLREGLRRTVEWYLNNRWWWE
PLIKDKFFVEDEPWKVKVSK
NT seq 963 nt   +upstreamnt  +downstreamnt
atgataattattggtggtgctggtttcataggctctgcgtttgtaagagaggtgaatagg
aggggaattaaaccggttgtgattgatttacttacttatgccggaaggatggagaactta
attggtactaatcatgatttcgtaagggctgacattaggagtgaggagattcataatatt
ttgaaagaaaaagagtctgctagtaatgtcgttgttaattttgcggctgagactcatgtg
gataggtctatttataagcctcaggattttgtgactactaatgtcataggagtagtgaac
ctactagaagctgctaggaaatatgattttaattatgttcatatttctactgatgaggtt
tatggtgaggagtgtggggatgaggattctcctttaaaaccatcttcaccttatagtgct
tctaaggcttctgctgatttattcgttaaggcttatgttaggacttacgggattaaggct
ataattataaggccttcaaacaactacggccctaggcagttcccagaaaagcttattcct
aaggtgataattaggactttgatgggggagtatgtccctatttatggtgatgggagagct
gagagggattggatttatgttgaggatactgctaggataatttatgatattttagaaatg
gcggaatggagaggggaagtttataatattcctggaggacagaggtatagtgtgcttgac
gttgttaagatgatcggtgaggtcatggggagggaggtaaaaattaagtttgttagtgat
aggcccggtcatgataggaggtattgtatgattactaagcttaagtatgaggttacgccg
ttaagggaggggttgaggaggactgttgagtggtatttgaataataggtggtggtgggag
ccattgataaaggataagttctttgtagaagatgagccttggaaagtaaaagttagtaaa
taa

DBGET integrated database retrieval system