KEGG   Sulfurisphaera tokodaii: STK_19915
Entry
STK_19915         CDS       T00062                                 
Name
(GenBank) hypothetical protein
Organism
sto  Sulfurisphaera tokodaii
SSDB
Motif
Pfam: COPI_C
Other DBs
NCBI-ProteinID: BAB67085
UniProt: Q96Z41
Position
2005011..2005265
AA seq 84 aa
MDSEEAKNCSEIIRTLTLVLSQFGFKKNFDEKINGNLKEIVTATLMQLKCLKDNAKIVYT
LVEEGKFDEARERLLKISYELLRG
NT seq 255 nt   +upstreamnt  +downstreamnt
atggacagtgaggaggcaaagaattgttcagagattattaggactctaacactagtccta
agtcaattcgggtttaagaagaattttgacgaaaaaattaacggcaatttgaaagaaatt
gttaccgcaacgcttatgcaacttaaatgtttaaaggataatgcaaagatcgtatataca
ctagtagaagaaggtaagtttgatgaagctagagaaaggttactcaaaatatcttacgaa
ctgttaagggggtga

DBGET integrated database retrieval system