KEGG   Sulfurisphaera tokodaii: STK_20080
Entry
STK_20080         CDS       T00062                                 
Name
(GenBank) putative transposase
  KO
K07496  putative transposase
Organism
sto  Sulfurisphaera tokodaii
Brite
KEGG Orthology (KO) [BR:sto00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99976 Replication and repair
    STK_20080
SSDB
Motif
Pfam: OrfB_Zn_ribbon DZR HypA LytTR NRDD C1_1 Ribosomal_L32p C1_2
Other DBs
NCBI-ProteinID: BAB67104
UniProt: Q96Z22
Position
complement(2022659..2023807)
AA seq 382 aa
MARRVKAIRATVSMKIALSEPLLALVNNYVKALRYSLFWLKENVKNPEEKGVLGRVHEEL
YDKLRGEYNLPSKVAEDCYRDALSVYKGWYNNPRRGRFPRVYKPTVWLTPKASYNIDFNK
MVARIAGVGELPILGYPRNIKDYMDWKMKEARLVIKGDKAFLKVVFEKKKVKIQPRGSVA
VDINMNEIVVGKDDTRYVRISTRLHEVHHWKSLAEVLQRKYPKRWRVNKRILVRIKYFYS
KAKRIMEDFARKVGKWVVEVAEDFGANVIKLENLKNLIKHVNKLPSEFRDKLYLMQYRRV
QYWIEWQAKKHGLLVVYVNPHYSSVSCPKCGKKMKEVGYRYFSCPSCGYENDRDVIGIMN
LNRRGSLTLSSAPQMRDVVPNR
NT seq 1149 nt   +upstreamnt  +downstreamnt
atggctaggagggttaaagcgatcagagctactgtttcgatgaagatcgccctatctgaa
cccctcctagctcttgtgaataactacgttaaggcactacgttattcgttgttttggttg
aaagaaaatgtgaaaaatccggaagagaagggtgtgttaggaagagtccatgaggagtta
tatgataagttaagaggggaatacaatctaccatcaaaggttgctgaggactgttatagg
gatgcactctcagtatacaagggttggtataataacccaaggaggggtaggtttcctaga
gtgtataagccgactgtatggttaacaccaaaagcaagttataacatagattttaacaag
atggtggctaggattgctggtgtcggtgagctcccaatccttggttatcctagaaacatt
aaggactacatggactggaagatgaaggaggcaaggttggtaatcaagggtgataaagcg
tttcttaaagtggtttttgagaaaaagaaagtaaaaattcaacctaggggtagtgttgct
gttgatattaacatgaatgagattgttgttggtaaggatgatactcgttatgttaggatt
tctacacgccttcatgaggttcatcattggaagtctttagctgaagttctgcagagaaag
taccctaagaggtggagggtgaataagagaattcttgtaaggattaagtacttctactct
aaggctaagcgaatcatggaggattttgctagaaaggttgggaagtgggttgttgaggtt
gcagaggattttggtgctaatgttattaagttagagaacctcaagaatttgattaaacat
gttaataaattaccatctgagtttagggataaactgtatttgatgcaataccgtcgtgtt
cagtattggattgagtggcaggctaagaaacacggcttgttggttgtgtatgttaatcct
cactattcttctgtctcttgccctaagtgtggtaaaaagatgaaagaagtaggttatagg
tacttcagctgtccgtcttgtggttatgagaatgatagggatgttattggaattatgaat
cttaacaggagggggtctctgaccctctcgtctgcccctcaaatgagggatgtagtcccg
aaccgatga

DBGET integrated database retrieval system