KEGG   Sulfurisphaera tokodaii: STK_20150
Entry
STK_20150         CDS       T00062                                 
Name
(GenBank) putative transposase
Organism
sto  Sulfurisphaera tokodaii
SSDB
Motif
Pfam: HTH_23 Zn_Tnp_IS1 Terminase_5 HTH_28 HTH_38 Sigma70_r4_2 zf-ribbon_3 HTH_Tnp_1 HTH_Tnp_ISL3 HTH_29 HTH_Tnp_IS630 Zn_Tnp_IS1595 Zn-ribbon_8 CENP-B_N DUF1804 GerE HTH_Tnp_IS1 OrfB_Zn_ribbon Lar_restr_allev HTH_40 RNA_POL_M_15KD DUF6076 TBPIP_C Nudix_N_2 zf_UBZ FYVE
Other DBs
NCBI-ProteinID: BAB67112
UniProt: Q96Z14
Position
2031328..2031630
AA seq 100 aa
MGRKPVFRQDLACPSCGSHHVVKCGKPLGRQRFLCRDCGKYFLADAVYHHHSKEVREKAL
RMYTNGMSMRAISRVLNVPLGTVFTWVKRYDKRKYEKLVE
NT seq 303 nt   +upstreamnt  +downstreamnt
atgggtaggaagcctgtatttaggcaagatttagcttgtccctcttgtggtagtcatcac
gtcgttaagtgtggtaagcctcttggtaggcagaggtttctgtgtagggattgcggtaag
tacttccttgcagacgcggtttatcaccaccactctaaggaggtgagggagaaggctttg
aggatgtatactaatggtatgagtatgagggctatttctagggttcttaatgtgcctttg
ggtactgttttcacttgggttaagcgttatgataagaggaagtatgagaagctagtggag
tag

DBGET integrated database retrieval system