KEGG   Sulfurisphaera tokodaii: STK_20210
Entry
STK_20210         CDS       T00062                                 

Definition
(GenBank) putative glycosyltransferase
Organism
sto  Sulfurisphaera tokodaii
SSDB
Motif
Pfam: Glyco_tranf_2_3 Glycos_transf_2 Glyco_trans_2_3 Glyco_transf_21 Glyco_tranf_2_2 Osmo_MPGsynth
Other DBs
NCBI-ProteinID: BAB67119
UniProt: Q96Z07
Position
complement(2038392..2039639)
AA seq 415 aa
MVIMFHLFHGVSYFIYSLSFTIITILYFFLNSFFAVISNNRKTQHSSFYNLSDLTVVIPV
YKEEIDIFEKVIRTLYDTRLEFIVVGDSVLEPYKSITERYGGKFIYMREHKGKRYALAEG
VKYVRSPLVMFLDSDTIIYKDSILKMLSVFDESVGGVGPNIRIMYDEKNKYAYYYGEFFE
RISEIVNRAVNYFGSAIILSGQCVIYRTELVKPYILSKEFLEPKMFGRPIKISDDRDLTD
FVIKKGYRAVKVFDAVAYTKPPRDIKMFTKQVTRWTRANYLNFIREIADGSISKRGSLYV
FNMIYTNLLPLFTLLFLYMSFTRILKIYSSINVINTKLLLLLYLPTRYHSDFFIFYLFLH
YGGFIAIIPFVMTMIYLIPEDKLKTLIYGSIALAVQYIASLYAMITFWWQDWLTR
NT seq 1248 nt   +upstreamnt  +downstreamnt
gtggtgattatgtttcacttatttcacggagtctcatatttcatttattctctttcattc
acaattataactattctttatttctttttgaattcattttttgcagtaataagtaataat
agaaaaactcaacactcaagtttttataatctctctgatcttacagttgtgataccagtt
tataaggaggaaatagatatttttgaaaaagtgataaggactttatatgacacaaggtta
gaatttattgttgtaggggatagtgttctagaaccatacaaatcaattacggaaagatat
ggtggtaaatttatttatatgcgtgaacataaggggaaaagatacgcgttagccgaggga
gttaagtatgtaagatctcctctagtgatgtttctagatagtgatacgattatttataaa
gactctatactaaagatgttaagtgtttttgatgagtcagtaggtggagtagggccaaat
attagaattatgtatgacgagaaaaataaatatgcatattattatggtgaattctttgag
agaataagtgagatagtaaacagggcggtaaactattttggaagtgctataatattaagt
ggacaatgtgtaatatataggaccgaactcgtaaaaccatatatattatctaaagagttt
ttagagccgaaaatgtttggaagaccaattaaaatttccgatgatagagatttaaccgat
tttgttataaaaaaagggtatagggctgtaaaagtctttgatgcagtggcatatacaaaa
ccccctagagacataaaaatgtttacgaaacaagtaactagatggacaagagcaaattat
cttaattttataagggagatagctgacggtagtataagtaaaaggggttcattatacgtt
tttaatatgatatacaccaatctgttaccattatttacgctcttgttcctttatatgagt
ttcactagaattcttaagatctattcctcaattaatgtaattaatactaagctcttatta
ctattgtatctgccaacccgttaccattccgacttctttatcttttatttattcttgcat
tacggaggatttatagctataataccctttgtaatgaccatgatttatttaattccagaa
gataaattgaaaactctaatatacggttctatcgcactagcagtgcaatatattgcttcc
ctatatgctatgataactttctggtggcaagattggttaactagataa

DBGET integrated database retrieval system