KEGG   Sulfurisphaera tokodaii: STK_20230
Entry
STK_20230         CDS       T00062                                 
Symbol
fumC
Name
(GenBank) fumarate hydratase
  KO
K01679  fumarate hydratase, class II [EC:4.2.1.2]
Organism
sto  Sulfurisphaera tokodaii
Pathway
sto00020  Citrate cycle (TCA cycle)
sto00620  Pyruvate metabolism
sto00720  Carbon fixation pathways in prokaryotes
sto01100  Metabolic pathways
sto01110  Biosynthesis of secondary metabolites
sto01120  Microbial metabolism in diverse environments
sto01200  Carbon metabolism
Module
sto_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sto_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sto00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    STK_20230 (fumC)
   00620 Pyruvate metabolism
    STK_20230 (fumC)
  09102 Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    STK_20230 (fumC)
Enzymes [BR:sto01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.2  fumarate hydratase
     STK_20230 (fumC)
SSDB
Motif
Pfam: Lyase_1 FumaraseC_C RuvA_C
Other DBs
NCBI-ProteinID: BAK54712
UniProt: F9VP65
Position
2040350..2041666
AA seq 438 aa
MKYTETAPKLFMNTGTRFPRKIIWAMGLIKYAAAKVNSDLNQLEKEIAKGIMQAAKEVME
GKHDDKIVLDVFQTGSGTGLNMNINEVIAERATEMIGKKVHPNDHVNLGQSSNDTVPTAI
RIAATSAVEEQLIPALSKFVSILNRKSEEFKDIVKSGRTHLRDALPVTLGQELSAYADAF
YHDMTNLQQVLEYVKELPIGGTAVGTGLNSHPEFQLRVIQEVNNETGLGFKPANKFRGLR
LLTDLLSLSGIMRTIAVDLYRLGQDIRLMFSGPMTGFNEIDLPTQEEIAGSSIMPGKTNP
VTVEATLLVSAQVVGLDHANQFASMLGEFELAMGVPLIGYNVVTQINLLTEALNKFGDLV
INGMVPNIERMKRYAESSPSLVTVISPIIGYDKASEIGKRLSKGMSIREALKELGFKDDE
IDRILDLSKLVKPGFPAK
NT seq 1317 nt   +upstreamnt  +downstreamnt
atgaaatacactgagactgcaccaaaactttttatgaacacaggaactagatttcctaga
aaaataatctgggctatgggacttataaaatacgcggcagcgaaagttaattctgatctt
aaccagttagaaaaagaaatagctaaaggtattatgcaagcagcaaaagaagttatggaa
ggaaaacatgatgataaaatagttttagatgtatttcaaacaggctctggtactggacta
aatatgaatattaatgaagtgatagcagaaagggcaactgaaatgattggaaaaaaagtt
cacccaaatgatcacgtaaatttagggcaatcatctaacgatactgttcctactgcaata
agaatagcagcaacttcagcagttgaagaacaacttataccagcacttagtaaatttgtt
tctattcttaatagaaaaagtgaagaatttaaggatattgtgaaatctggaaggactcat
ttaagggacgcgttaccagttaccttaggtcaagagctttcagcatatgcagacgctttc
taccacgatatgaccaatttacaacaagtactagaatatgttaaggagcttcctattggt
ggcactgcagtaggtactggattaaactcacatccagaatttcaactgagagttattcaa
gaggttaataatgaaactggattaggcttcaaaccagctaataagtttagaggattaagg
cttttaacggacttacttagtctaagcggtattatgagaacaattgcggtagatctttac
agacttggacaagatattagattaatgttttctggaccaatgactggtttcaatgaaata
gatctacctactcaagaagaaatagctggaagtagtattatgccgggtaaaacaaaccca
gttactgtggaggcaacattattagtctcagctcaagtagtaggattagatcatgccaat
caatttgcatcaatgttaggcgagtttgagttagccatgggcgttcctttgattggatat
aatgtggttactcaaataaacttacttacagaggcattaaataaatttggagatttggta
attaatggtatggttcctaatatagaaagaatgaaaagatatgctgaaagcagtccttca
ttagttaccgtaatatcacctattattggttatgataaggctagcgaaatagggaagaga
ttaagcaaaggaatgtctataagagaagcattaaaagagttaggctttaaggatgatgaa
atagatagaatactagatttatcaaaattagttaagccaggttttcctgcaaaatga

DBGET integrated database retrieval system