KEGG   Sulfurisphaera tokodaii: STK_20390
Entry
STK_20390         CDS       T00062                                 
Name
(GenBank) putative iron-dependent regulator
  KO
K03709  DtxR family transcriptional regulator, Mn-dependent transcriptional regulator
Organism
sto  Sulfurisphaera tokodaii
Brite
KEGG Orthology (KO) [BR:sto00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sto03000]
    STK_20390
Transcription factors [BR:sto03000]
 Prokaryotic type
  Helix-turn-helix
   Other families
    STK_20390
SSDB
Motif
Pfam: Fe_dep_repr_C Fe_dep_repress FeoA HTH_45 MarR HTH_5 HTH_24 MarR_2 GntR HTH_27 TrmB HTH_Crp_2 HTH_DeoR HTH_41 DUF4423 HTH_1 HemN_C AAA_assoc_C DUF2250 SoFic-like_C HTH_11 Ribosomal_S19e DUF6429 Phage_rep_org_N HxlR EAP30 PadR CggR_N LexA_DNA_bind HTH_20 HTH_IclR FeoC
Other DBs
NCBI-ProteinID: BAB67135
UniProt: Q96YZ1
Position
complement(2051110..2051745)
AA seq 211 aa
MELSEPLENYLKEIYEIELLKGYARVSDLILAFNVSPGTVSKALEKLEKIGLIERDNKKI
KLTAEGKKIAEKLIRAHRLSERLLTDIIGLDWIRAHQLAHRLEHIWPEDVVDKIDELLGK
PLTCPHGHPIPGREVKVNGIKLSEAECNKKYKVIMIIREEEWILSMADELNIKPGVEIKL
IKKNENDFVIEIDNKKESIPKALAEEVLVSE
NT seq 636 nt   +upstreamnt  +downstreamnt
atggaactatctgaaccattagaaaattacttaaaagagatttatgaaattgagttactt
aaaggatatgccagggtttctgatcttattcttgcttttaatgtatcacccggcacagtt
agtaaagctcttgaaaaattagagaaaattggattaattgaaagagataataagaaaatt
aaattaacagctgaaggtaaaaagattgctgagaagctaattagggcccatagactttct
gaaagattgctaactgatataatagggcttgattggattagggctcatcagcttgctcat
agacttgagcatatctggccagaagatgtggtagataaaattgatgaacttcttggtaaa
cctttaacttgtcctcatggtcatcctattccgggaagagaagttaaagtaaatggaata
aaattgtctgaagcagaatgtaataaaaaatataaagttataatgattataagagaagaa
gaatggattttatctatggccgatgagctaaatattaaacccggggtcgagataaaatta
attaaaaagaatgagaatgattttgtaattgaaattgataataaaaaagaatctattcct
aaagcactggctgaagaggtgttagtcagtgagtga

DBGET integrated database retrieval system