KEGG   Sulfurisphaera tokodaii: STK_20780
Entry
STK_20780         CDS       T00062                                 
Symbol
pelA
Name
(GenBank) archaeal Pelota
  KO
K06965  protein pelota
Organism
sto  Sulfurisphaera tokodaii
Brite
KEGG Orthology (KO) [BR:sto00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:sto03019]
    STK_20780 (pelA)
Messenger RNA biogenesis [BR:sto03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Other transport factors
     STK_20780 (pelA)
SSDB
Motif
Pfam: eRF1_1 eRF1_3 baeRF_family2 eRF1_2 Resolvase Ribosomal_L4
Other DBs
NCBI-ProteinID: BAK54728
UniProt: Q96YU9
Position
2082405..2083430
AA seq 341 aa
MKILEFDDKKGIMKLHIENEDDLWILHIILKKGDRVVAKTTRDVSMGRESRRIPMIIKLQ
VEYTEFQSFTSRLRIHGIILDAPERFGIKGSHHTINLDIGDEIVIEKDHWNKFEIEKIKR
QEEKHLKMLIVLVDFDEYLIALPMKQGIRILAEKSLRTPNKEEENIIEDNAKEVANEVLS
YAESLGIEVVLLAGPGPFKEIVSNFLKNIKLYVDSVSSATRSGLNEILKRDIIDQISRDY
EISEETKIMEKIMENLAKNTGLVAYGKEEVKKSAEYGAVDKLLVIEDLLSSDEEERMEIE
KIMEEVENKNGRVLIVPKDSPIYYEVRNLTGLIALLRFRIN
NT seq 1026 nt   +upstreamnt  +downstreamnt
atgaagattttagagtttgatgataaaaaggggataatgaaattacatatagagaatgag
gatgatttatggatattacacattatactaaaaaaaggtgatagagtagttgcaaaaact
acgagagacgttagtatgggaagagaaagcagaagaataccaatgattatcaagttacaa
gtggaatatactgaatttcaatcatttacaagcaggctcagaattcatgggataatatta
gatgcaccagagagattcggaataaaaggttctcatcatacaataaaccttgatattgga
gatgaaattgtaatagagaaagatcattggaataaatttgagatcgagaagataaaaagg
caagaggaaaaacatctaaagatgctaatagttctcgttgattttgatgaatatcttatt
gcacttccaatgaagcaaggtataaggatactagcggaaaaatcattaagaaccccaaat
aaggaagaagaaaatatcatagaagataatgcgaaagaagttgctaatgaagtactttcc
tatgcagaatccttaggtatagaagttgtattacttgcaggaccagggccttttaaggaa
atagtatccaattttttaaagaatataaaactttacgtagatagtgtatcctcagctaca
agaagtggactaaatgaaattttgaaaagagatataatagatcagatcagcagagattac
gaaatttcagaagaaaccaagataatggaaaaaataatggaaaatttggctaaaaacact
ggattagtggcatatggaaaggaggaagttaagaaaagtgcagaatacggtgctgtagat
aaattgctagtaattgaggatcttttatcttcagatgaagaagagagaatggaaattgag
aagataatggaagaagtagaaaataaaaacgggagagttttgatagttcctaaagattct
cctatctattatgaagtaagaaatctcactggactgatagctttacttagatttagaata
aactaa

DBGET integrated database retrieval system