KEGG   Sulfurisphaera tokodaii: STK_22360
Entry
STK_22360         CDS       T00062                                 
Name
(GenBank) putative DtxR family transcriptional regulator
  KO
K03709  DtxR family transcriptional regulator, Mn-dependent transcriptional regulator
Organism
sto  Sulfurisphaera tokodaii
Brite
KEGG Orthology (KO) [BR:sto00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sto03000]
    STK_22360
Transcription factors [BR:sto03000]
 Prokaryotic type
  Helix-turn-helix
   Other families
    STK_22360
SSDB
Motif
Pfam: Fe_dep_repr_C HTH_45 Fe_dep_repress TrmB CggR_N HemN_C RuvB_C DUF4423 HTH_36 FeoC
Other DBs
NCBI-ProteinID: BAB67345
UniProt: Q96YD2
Position
2244129..2244542
AA seq 137 aa
MGNILIVKLSRRELSYLLSVKKYNDEGKPAKLSWISKDLNVSVASAYEEISHLESKGFLK
KSDKGIFITDEGKKAIDSLLRAHRVIETFLVKIGLSPDQACNYTKQFDYSVPDEVIERIY
EYLGKPEKCPHGENIPY
NT seq 414 nt   +upstreamnt  +downstreamnt
gtgggaaatattcttattgtgaaactgtcaagacgtgagctctcatatttattatcagta
aagaaatataatgacgaagggaaaccagcaaaattatcgtggatttcaaaagatctaaat
gtaagtgtagctagtgcttatgaagagatttcacatttagagagtaaaggatttttaaaa
aaatctgataaaggtatattcataactgatgaggggaaaaaagcaatagattcccttctg
agagctcatagagttatcgagacattcttagttaaaattggtttatctccagatcaagca
tgtaattatactaagcagtttgattattctgtaccggacgaagttatagaaagaatttat
gagtatcttggaaagccagaaaaatgtccacacggtgaaaatattccctattaa

DBGET integrated database retrieval system