KEGG   Sulfurisphaera tokodaii: STK_22430
Entry
STK_22430         CDS       T00062                                 
Symbol
nudF
Name
(GenBank) ADP-ribose pyrophosphatase
  KO
K03574  8-oxo-dGTP diphosphatase [EC:3.6.1.55]
Organism
sto  Sulfurisphaera tokodaii
Brite
KEGG Orthology (KO) [BR:sto00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sto03400]
    STK_22430 (nudF)
Enzymes [BR:sto01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.55  8-oxo-dGTP diphosphatase
     STK_22430 (nudF)
DNA repair and recombination proteins [BR:sto03400]
 Eukaryotic type
  Other factors with a suspected DNA repair function
   Modulation of nucleotide pools
    STK_22430 (nudF)
 Prokaryotic type
    STK_22430 (nudF)
SSDB
Motif
Pfam: NUDIX NUDIX_4 NUDIX_2
Other DBs
NCBI-ProteinID: BAK54767
UniProt: F9VPC0
Position
2251859..2252299
AA seq 146 aa
MEYPLVAVGGVIFNKQRKVLLVKRKNPPNKGSWAIPGGKVKYGETLEEAVKREIKEETNL
DVRVKELLAIVEIIKEGFHYVILDFVCENIEGKLMASSDAEDARFFSLDELTNISVSPTT
IEMLKRYFDGEKTPIIITERSTQISK
NT seq 441 nt   +upstreamnt  +downstreamnt
atggaatatcctttagtagcagtaggaggagttattttcaataaacagagaaaagtttta
cttgtaaaaagaaaaaatccaccgaataaaggtagttgggctatacccggaggaaaggta
aaatatggtgaaacattagaagaagctgttaagagagagattaaagaagaaacaaattta
gatgttagagtgaaggagttattagctatagtcgaaataattaaggaaggttttcactat
gttattctagatttcgtgtgtgaaaatattgagggaaaacttatggcaagtagtgatgct
gaagatgcgagatttttctctctagacgaattaacaaatatatcggttagtcctactacc
atagagatgctaaaaagatattttgacggtgaaaaaacaccaatcataataacggaaaga
tctactcaaatctccaagtag

DBGET integrated database retrieval system