KEGG   Sulfurisphaera tokodaii: STK_22470
Entry
STK_22470         CDS       T00062                                 
Symbol
nox
Name
(GenBank) NADH oxidase
  KO
K18367  CoA-dependent NAD(P)H sulfur oxidoreductase [EC:1.8.1.18]
Organism
sto  Sulfurisphaera tokodaii
Brite
KEGG Orthology (KO) [BR:sto00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    STK_22470 (nox)
Enzymes [BR:sto01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.18  NAD(P)H sulfur oxidoreductase (CoA-dependent)
     STK_22470 (nox)
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox Pyr_redox_dim Pyr_redox_3 NAD_binding_8 DAO GIDA HI0933_like FAD_binding_2 3HCDH_N TrkA_N ApbA NAD_binding_2 NAD_Gly3P_dh_N Lys_Orn_oxgnase
Other DBs
NCBI-ProteinID: BAB67357
UniProt: Q96YC0
Position
2255086..2256408
AA seq 440 aa
METLVAVGGGAAGMSASSRARRLKPDMEIVVFESTKMVSHAPCGIPYFVEGLFNDENLFM
TYTPQFFEEKRKIHVKTNTKVTEIDFDSRIVYGESREGKIKAEYDYLVISTGAIPRKIPV
EDGNDRIFYAHHPANAVELRERLWSLNTIAIVGGGILGIEMAEALTHIGKKVILIHRSKY
LLNKTIDTELGNIITQRVSKDAEVRLNESVETIKEGGRLIVTDKGKYQVDGTIIAIGVAP
NVELVKDKIKLGETGAIKVDDHMRTNYREVYSAGDNTESVNIITKKPAWVPFAPVANKMG
YVAGSNIGGHEMRFPGVVNTQITKYKEFYIGRVGLQEDEARLHGFKPISATISGKTRARY
YPDAKDIHVKIIADENTKRILGAQIVGGEEVLGRIDMMAAAIMKGFTIEDTFFIEMGYLP
AISRVWDPVIVAIRQLMKDE
NT seq 1323 nt   +upstreamnt  +downstreamnt
atggaaactttagtagcagtaggtggcggagctgctggaatgagtgcttcttcaagagct
aggagattaaagccagacatggaaattgttgtatttgaatcaacaaaaatggttagtcat
gcaccttgtggaattccttatttcgttgaaggattatttaatgacgagaatctttttatg
acttatactccacaattttttgaagaaaagagaaaaattcatgtaaaaactaatacgaaa
gtaacagaaattgattttgattcccggatagtatatggggaatctagagaaggaaaaatc
aaagctgaatatgattatttagttattagtacgggagctatacctagaaaaattccagtt
gaagacggaaatgataggattttttatgcacatcatccggctaatgcagtagaattaaga
gagagactttggtctttaaatactatcgcaatagtaggaggtggaatattaggtatagaa
atggcggaggcactaactcatataggcaaaaaggtaattttgattcacaggagtaagtat
ttgctaaataagactatagacactgaactgggaaatataataactcaaagagtttctaaa
gatgcagaagttagactcaatgagagcgttgagactataaaggaaggaggtaggttaata
gtcacagataagggaaagtaccaagtagatggcactataatagcaataggagttgcacca
aatgttgaacttgtaaaagataaaataaaattaggagagactggagctataaaggttgat
gatcacatgaggactaactatagggaagtttattcagctggtgataacactgaatcagta
aatataataactaaaaaacccgcatgggttccttttgcaccagtagctaataagatgggt
tatgtggctggaagtaatataggcggtcatgaaatgagattcccaggagttgtgaacacc
caaattactaagtacaaagaattttatataggacgagtgggtttacaagaagatgaggca
aggcttcacggatttaaacctatatcagcaactataagtgggaagactagagcaagatat
tatcctgacgctaaagatattcatgtaaaaattatagcagatgaaaacactaagagaatt
ttaggtgctcaaatcgttggtggtgaagaagtattaggacgaatagatatgatggctgca
gcgataatgaaaggctttaccatagaagatacattcttcattgagatgggttacttacca
gcaattagtagagtttgggatccagtaattgtagcaattagacaacttatgaaagatgaa
taa

DBGET integrated database retrieval system