KEGG   Sulfurisphaera tokodaii: STK_22520
Entry
STK_22520         CDS       T00062                                 

Definition
(GenBank) putative NAD-dependent alcohol dehydrogenase
Organism
sto  Sulfurisphaera tokodaii
SSDB
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 ELFV_dehydrog PALP 2-Hacid_dh_C CoA_binding
Other DBs
NCBI-ProteinID: BAB67362
UniProt: Q96YB5
Position
2260796..2261794
AA seq 332 aa
MIMMKALIFEKSGIENLKISDVKEPTLGPHDVLVKVKMAGVNPIDYFVVNFIPVTPMPHI
PGAEIYGEVAKVGDHVKSVNIGDKVVVYNRVFDGKCDMCLQGMEQLCRNGGIISIITNGG
FSEYFSVSEHNLVKVEGINDEIAASLPVAALTAYHALSTVQVFGKTVVVFGASGNTGQFA
VQFAKMMGGYVIAVSNKNWVKEFGADEVVSYDKVEEKVKELTNGRMADIVINSVGSSVWD
KSLSVLGLNGKLLFFGGITGSNVSLDLGAIYGKHASLIGTTGGNRKELVELASMAKKLKV
KVWKVRKLEDGKEALQDLFNKNRDGRILIKIE
NT seq 999 nt   +upstreamnt  +downstreamnt
atgattatgatgaaagccttaatttttgagaaatcgggaattgaaaacctaaaaatatct
gatgtaaaagaaccaactttaggtccgcatgatgttctcgtaaaagtaaaaatggctggt
gttaatcctattgattattttgtagttaattttataccagtaactcctatgcctcatatc
cctggtgcagagatatacggagaagtcgctaaagtaggggatcacgtaaaaagtgtaaat
atcggcgataaagttgttgtctataatagagtatttgatggaaagtgtgatatgtgctta
caaggtatggaacagttatgtagaaatggtggaataattagtataataactaatggaggt
ttttctgaatatttttctgtttcagaacataatcttgtaaaagttgaagggattaatgat
gagatagctgcaagtttaccagtagccgcattaaccgcttatcatgcattaagcactgtg
caagtatttggtaaaactgtagtggtttttggtgctagtggaaatacaggacaatttgca
gttcagtttgctaaaatgatgggaggatatgttattgcagtaagtaacaaaaactgggtt
aaggaatttggtgctgatgaagtagttagttatgataaagtggaggaaaaagtgaaagaa
ctgactaatggaagaatggcagatatagttataaattcggtaggctcatccgtttgggac
aaaagcctatcagttctagggttaaatggaaagctcttgttctttggaggtataacgggt
agtaatgtaagtttagatttaggagcaatttatggaaaacatgctagtctaataggaact
actggaggtaatagaaaagagttagtagaattagcctctatggctaagaaattgaaagta
aaagtatggaaagtaagaaaactggaagatggaaaagaagctttacaagatttatttaat
aaaaatagagatggaagaatattaataaaaattgaataa

DBGET integrated database retrieval system