KEGG   Sulfurisphaera tokodaii: STK_22690
Entry
STK_22690         CDS       T00062                                 
Name
(GenBank) putative transketolase
  KO
K00615  transketolase [EC:2.2.1.1]
Organism
sto  Sulfurisphaera tokodaii
Pathway
sto00030  Pentose phosphate pathway
sto01100  Metabolic pathways
sto01110  Biosynthesis of secondary metabolites
sto01120  Microbial metabolism in diverse environments
sto01200  Carbon metabolism
sto01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sto00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    STK_22690
  09109 Metabolism of terpenoids and polyketides
   01051 Biosynthesis of ansamycins
    STK_22690
Enzymes [BR:sto01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.1  transketolase
     STK_22690
SSDB
Motif
Pfam: Transket_pyr Transketolase_C PFOR_II
Other DBs
NCBI-ProteinID: BAB67378
UniProt: Q96Y99
Position
2277950..2278891
AA seq 313 aa
MMQRSTLPMRDTFGRLLAELGEKNKDIIVITADVGNSTRAMYFREKFPDRYFNVGISEQD
MVNFAAGLSVTGFKPIVVGFAMFVMRAWEQIRNSIARMNLDVKIMVTHSGYSDSGDGSSH
QALEDIALMRVLPNMKVIIPADSEDVKRSLPVVVNELRGPLYYRMGRDYTPVITEGLDYD
FKLGKAYVLRDGEDLAIMGAGVVLADALKAAEELEKMGISAAVINLMSIKPIDEDLIEYY
ARKTGRIITIEEHSIYGGIGSAVAEVVVKKYPVPMRFIGAITFGRSARSERDLLDFYGIN
YKSILNAVMELVK
NT seq 942 nt   +upstreamnt  +downstreamnt
atgatgcaaagaagtaccttaccaatgcgtgatactttcggtagattattagctgaattg
ggagagaaaaataaagatataatagttattactgcagatgttggaaactctactagagct
atgtactttagggagaaattcccagacagatattttaatgtaggtatttctgagcaggat
atggttaattttgctgcgggcttatcggttactggttttaaaccgatagtcgttgggttt
gcaatgtttgtaatgagagcatgggagcaaataagaaactctattgctagaatgaattta
gatgtaaaaataatggttactcattctggatatagtgatagtggtgatggttctagtcat
caagccttagaggatatagctttaatgagagtgttaccaaatatgaaagtaattattcca
gctgattcggaggatgtaaaaaggtctttaccagtagtagttaatgaacttagaggtcca
ttatattatagaatgggaagggattatacgccagtaattacagaaggattagattatgac
tttaaattgggcaaagcttacgtgttaagagatggagaagatttagcaattatgggtgct
ggagttgttctagctgatgccttaaaagctgctgaggaattagaaaagatgggtataagt
gctgccgttataaacttaatgagtataaagcctattgacgaagatttaatagaatattat
gcgagaaaaaccgggagaataattacaatagaagagcattctatatacggtggtataggt
tcagctgtagctgaagttgtagtaaagaagtatccagtaccaatgagattcattggtgct
attacctttggaagatctgctaggagcgagagagatttacttgatttctatggtataaat
tataagtctatcttaaatgcggttatggaattagtgaagtga

DBGET integrated database retrieval system