KEGG   Sulfurisphaera tokodaii: STK_22870
Entry
STK_22870         CDS       T00062                                 
Name
(GenBank) putative oxidoreductase
Organism
sto  Sulfurisphaera tokodaii
SSDB
Motif
Pfam: adh_short_C2 adh_short KR THF_DHG_CYH_C Epimerase F420_oxidored NAD_binding_10 DUF460 Shikimate_DH 3HCDH_N NAD_binding_7 Nab2 Ham1p_like ADH_zinc_N NAD_binding_2
Other DBs
NCBI-ProteinID: BAB67397
UniProt: Q96Y80
Position
2296555..2297262
AA seq 235 aa
MRLKGRRVLIVGVSKGLGYALAYFLLKEGASVVINSRNEEKLKEIKKSLESIGEITYVVG
DVSTLEKAREVVEKAGNFTDLVVTVGGYIEDTVEDLKALDEMINNHIKIPLYVVHYSLSK
LKEGSTIVLVSAIRGIYTAYPTQLSYAVGKAGLAKEVEILASELLSRGIRVVGIAPSFID
GDFVPDRDWKKLRKLGDFKAPPEDFARVIVWLLTEEAEWVNGVVIPVDGGARLKL
NT seq 708 nt   +upstreamnt  +downstreamnt
atgagactaaaaggaagacgcgtattaattgttggagtgagcaaaggattaggctatgct
cttgcatactttctacttaaggagggagccagtgttgtaattaattctcgtaatgaagag
aaactaaaagaaataaagaagagtctagagagtataggtgagataacttatgttgtcgga
gatgtatcaacgctggaaaaggctagggaagttgttgaaaaggctggtaattttactgac
ttagttgtaactgttggaggttacatagaagatactgtagaagatttaaaagctttagat
gagatgataaataaccatattaaaattcctttatatgttgtacactattctttaagtaaa
ttaaaagaaggttcaactatagttctagtttcagcaattaggggtatttatacagcttat
cctacacaactttcttatgctgttggaaaggcaggtttagctaaagaagttgaaatttta
gcctctgaattgctgagtagaggaattagggttgtaggaattgctccaagttttatagat
ggagactttgtaccagacagggactggaagaaattgaggaagcttggcgattttaaagct
cctcccgaagattttgcaagggttatcgtttggttattaactgaagaggctgaatgggtt
aatggtgttgttataccagtagatggtggtgctagactaaaattataa

DBGET integrated database retrieval system