KEGG   Sulfurisphaera tokodaii: STK_23070
Entry
STK_23070         CDS       T00062                                 
Symbol
purT
Name
(GenBank) phosphoribosylglycinamide formyltransferase 2
  KO
K08289  phosphoribosylglycinamide formyltransferase 2 [EC:6.3.1.21]
Organism
sto  Sulfurisphaera tokodaii
Pathway
sto00230  Purine metabolism
sto01100  Metabolic pathways
sto01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sto00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    STK_23070 (purT)
Enzymes [BR:sto01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.1  Acid-D-ammonia (or amine) ligases (amide synthases)
    6.3.1.21  phosphoribosylglycinamide formyltransferase 2
     STK_23070 (purT)
SSDB
Motif
Pfam: ATP-grasp PurT_C CPSase_L_D2 Dala_Dala_lig_C ATP-grasp_3 GARS_A PylC-like_N ATPgrasp_ST LAL_C2 ATP-grasp_4 ATP-grasp_5 PurK_C Sf6_terminase
Other DBs
NCBI-ProteinID: BAB67417
UniProt: Q96Y60
Position
complement(2312957..2314159)
AA seq 400 aa
MNFMEIGTPLFEGAKKLLWLGGGELGKEMVIEAQRMGIETVVVDRYDMAPAMHVAHRKYV
VNMLDGNAIKSIIKKENPDAIITEIEAINTDALLELESEGYKVIPNAKAVKICMNRIELR
KLAAEKVKVPTTQYGFAENPEEVKKICKDIGYPCIIKPEMSSSGHGHEVVYNESEVEQKF
KEAITHARGKSEQVIVEEYVKIDRELTVLTYRYLDDKGVVTKTITPIEHQRPSDVYYYVE
SWHPSTVDKDIIERAQEYATRVVNELGGFGIFGVEIIVSGNRVLFSEVSPRPHDTGLVTM
ASLDINEFQIHVRSALGLPTPEVKIVSPAAAHVILANNEGWAPKFLNVEKALQIPGVQIR
LFGKPSTYYKRRMGVVLATGNTVEEAKEKARKAASLVLVT
NT seq 1203 nt   +upstreamnt  +downstreamnt
atgaatttcatggagataggtactcctttattcgaaggagcaaagaaacttctctggcta
ggtggaggagagttaggaaaagaaatggtaattgaggcacaaagaatgggtatagagaca
gttgtagttgataggtatgatatggccccagctatgcacgtagcccatagaaaatacgtt
gttaatatgttagacggaaacgcaataaagagtattataaagaaagagaacccagacgca
ataattacagaaattgaggctataaacacagatgcgctattagagttagaaagtgaagga
tacaaagtaattcctaacgctaaggccgtaaaaatctgcatgaatagaattgaattaagg
aagttagcggcggaaaaagttaaagtaccaacaacacagtatggatttgctgaaaatcct
gaagaagtaaagaaaatttgcaaggatattggatatccttgtataataaaaccagaaatg
agttctagtggacacgggcatgaggttgtatataatgaatctgaagtagaacaaaagttt
aaagaagctattacacacgcaagaggaaaaagcgaacaagtaatagtagaagaatacgtt
aaaattgacagagaacttacagttttaacctataggtatttagatgataaaggagttgta
actaagacaattaccccaattgaacatcaaagaccctcagatgtgtattactacgtggaa
tcttggcacccctcaacagtggataaagatataatagaaagagcccaagaatatgctaca
agagttgttaatgaattaggcggtttcggtatatttggtgtagaaataatagtctctggg
aatagggtattattcagtgaagtatccccaaggcctcatgatactggattagttacaatg
gcaagcctagatattaatgaatttcaaattcacgttaggagtgcattaggtttacctaca
cctgaggtgaagatagtttcgccagctgctgcacacgttattttggcaaataatgaagga
tgggcacctaaatttttaaatgtagaaaaagctttgcaaattcctggtgttcaaataagg
ctattcggaaaaccatcaacgtattataaaagaagaatgggagtggtattagctactggt
aatacagtagaggaagcaaaggaaaaagcaaggaaagcagcttcattagtcctagttact
tag

DBGET integrated database retrieval system