KEGG   Sulfurisphaera tokodaii: STK_23370
Entry
STK_23370         CDS       T00062                                 
Name
(GenBank) dolichol-phosphate mannosyltransferase
  KO
K00721  dolichol-phosphate mannosyltransferase [EC:2.4.1.83]
Organism
sto  Sulfurisphaera tokodaii
Pathway
sto01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sto00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:sto01003]
    STK_23370
Enzymes [BR:sto01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.83  dolichyl-phosphate beta-D-mannosyltransferase
     STK_23370
Glycosyltransferases [BR:sto01003]
 N-Glycan biosynthesis
  Dol-P-Man biosyntheisis
   STK_23370
SSDB
Motif
Pfam: Glycos_transf_2 Glyco_tranf_2_3 Glyco_tranf_2_4 DUF6614 PcF
Other DBs
NCBI-ProteinID: BAK54786
UniProt: F9VPD9
Position
complement(2338550..2339233)
AA seq 227 aa
MRGVLVPTYNEAENIKELIPRIRQYLPDAKIIIVDDDSEDSTAEIARKLDAIVFVRKGEK
GLGSALRFGLLKGLELGFEYLATMDADLSHDPIYLPKMFEEAKKADLVIGSRYIEGGKIE
NWPLKRRIISKGANMLAKTLLRIDVKDNTSGYRVYSRNAIEVVKDCKNADGYEFQICAVY
KVKRARLRIVEVPITFRDRSKGKSKLGSEKILNWFVYVLKLSLGFTS
NT seq 684 nt   +upstreamnt  +downstreamnt
atgagaggggttctagttccaacgtataatgaggcggaaaatataaaagaactcatacca
cgaattaggcaatatctaccagatgcaaaaatcattatagtagacgatgatagcgaagat
agtactgcagaaatagctagaaagttggatgctatagtttttgtaagaaaaggtgagaag
ggccttggcagtgcattaaggtttggactacttaaaggattagaattaggatttgaatac
ttagcaactatggatgctgacttaagtcatgaccctatttatttgcctaaaatgtttgaa
gaggcaaaaaaggctgatttggttataggttctagatatatagaaggtggaaaaattgaa
aactggcccttaaagagaagaattattagcaaaggagcaaatatgttagctaagacctta
cttagaatcgatgttaaagataatacttctgggtatagggtttattctaggaatgctatc
gaagtagttaaagattgtaaaaatgcagatggatatgagtttcaaatatgtgcggtatat
aaggttaagagggctagattaaggatagttgaagtacctataacctttagggatagaagt
aagggaaaaagtaagttaggaagtgaaaaaattcttaattggtttgtatatgttttaaaa
ctatcattaggatttacttcttga

DBGET integrated database retrieval system