KEGG   Sulfurisphaera tokodaii: STK_23400
Entry
STK_23400         CDS       T00062                                 
Name
(GenBank) hypothetical protein
Organism
sto  Sulfurisphaera tokodaii
SSDB
Motif
Pfam: Peptidase_M48 DUF4157 DUF5700 Peptidase_M78 TraL
Other DBs
NCBI-ProteinID: BAB67449
UniProt: Q96Y28
Position
complement(2341863..2342375)
AA seq 170 aa
MNLIIFAILPLIFIGDHLQLRRLKSLFTIQGIRIFLDNNESVNAYIIGKNLVITKGFLKL
DKSEQRAILAHEMSHIVLNHYLKMKIFVAVGLLFSLFLFQFNIVLSLISLILVFLLQKFI
SKRQEIQADRLAYSIVGDELKLVIKKYGDVESSIFSSHPTINTRLKMLSF
NT seq 513 nt   +upstreamnt  +downstreamnt
gtgaatttaattattttcgccatactccctctcatatttataggagatcatttacagtta
aggagattaaaatctttatttactatacaaggaataagaatatttcttgataataatgag
agtgtaaacgcatatataataggtaaaaatttagtaataactaaaggctttctaaaacta
gataaatccgaacaaagagcaatattagctcacgagatgtcacatattgtacttaaccat
tacctaaagatgaaaatcttcgtagctgtggggttattattctcattatttctgtttcag
tttaatattgttctttcactgatttctttgattttggtctttttattgcaaaaatttata
agtaaaaggcaagagatccaagctgataggcttgcatattctatagttggggatgaactt
aaactagtcattaaaaagtatggagacgtagagtctagcatattctcttctcatccaact
ataaacacgagacttaagatgttaagtttttaa

DBGET integrated database retrieval system