KEGG   Sulfurisphaera tokodaii: STK_23410
Entry
STK_23410         CDS       T00062                                 
Name
(GenBank) putative sorbitol dehydrogenase
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
sto  Sulfurisphaera tokodaii
Pathway
sto00051  Fructose and mannose metabolism
sto01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sto00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    STK_23410
   00051 Fructose and mannose metabolism
    STK_23410
Enzymes [BR:sto01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     STK_23410
SSDB
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C Fer4_17 Shikimate_DH Fer4_8
Other DBs
NCBI-ProteinID: BAB67450
UniProt: Q96Y27
Position
2342463..2343482
AA seq 339 aa
MKAVLLENGKVVIKEIPKPIIKDKGDVIVKMKACGLCGTDVEKICGQYTASQPILGHEPA
GIIDESSVDFLKSGQRVFAHHHVPCYECYYCTHGSPTMCPYYRKTNLDPGGFAEYFRVPA
WNVIRGGILILPDSVSFDEGAFIEPLATVVRAQRRVKINKGDSVLVVGAGPMGLLHVMMA
KANGASTVITSDVSDFRIEYATKVGADYSLNARKTDIPSEVKKLTDGRGADVAIIASGSP
SAILSGLLSVRKGGYVLLFGVPYKGTVLNYDISELLNNEISIISSNAAVEEDTKEALKLI
YERKVDVKKLITHRFPLDEFNEAVRVAKQGEAIKVIIYD
NT seq 1020 nt   +upstreamnt  +downstreamnt
gtgaaagctgtacttttagagaacggaaaggttgtaattaaggagatacctaagcctata
attaaggataaaggtgatgttatagttaagatgaaagcttgcggattatgtggtacagat
gtagaaaaaatttgtggacaatacacagcatctcagccaatactagggcatgagccagct
ggaataatagatgaatctagtgtagatttcttaaaatcaggacaaagagtatttgctcac
caccatgttccttgctatgagtgttactattgtactcacggtagtcctacaatgtgtcct
tattataggaaaacaaatcttgaccctggcggatttgctgagtactttagggtaccagct
tggaatgtaataaggggaggaattttaattttaccagactctgtatctttcgatgaagga
gcttttatagaaccattagctactgttgtgagagcacagagaagagtaaaaataaataag
ggagatagtgtcttagtggttggagctggacctatgggtttattacacgtaatgatggct
aaggctaatggtgccagtactgttataacatctgacgtatcagattttagaattgaatat
gctaccaaagtaggagcagactactcgttaaatgctagaaagactgatataccaagtgaa
gttaagaaattaacagacggtagaggagctgatgtagcaataatagcctcggggtctcct
tcagctatattatctggactactttcagtaagaaaagggggatacgtattactatttggt
gttccgtataaaggaacagtcttgaattacgatattagtgagcttttaaataatgaaatt
tcaataatatcaagtaatgctgcagtggaagaagatacaaaagaagcactgaaattaatt
tatgaaagaaaagttgatgtcaaaaaactgataacccataggtttccattagatgaattt
aatgaggccgtaagggtagctaagcaaggagaggccataaaggtaataatatatgattga

DBGET integrated database retrieval system