KEGG   Sulfurisphaera tokodaii: STK_23460
Entry
STK_23460         CDS       T00062                                 

Definition
(GenBank) protease HtpX homolog
  KO
K03799  heat shock protein HtpX [EC:3.4.24.-]
Organism
sto  Sulfurisphaera tokodaii
Brite
KEGG Orthology (KO) [BR:sto00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:sto01002]
    STK_23460
Enzymes [BR:sto01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.-  
     STK_23460
Peptidases and inhibitors [BR:sto01002]
 Metallo peptidases
  Family M48: Ste24 endopeptidase family
   STK_23460
SSDB
Motif
Pfam: Peptidase_M48 Peptidase_M56 DUF5700
Other DBs
NCBI-ProteinID: BAB67455
UniProt: Q96Y22
Position
complement(2347552..2348529)
AA seq 325 aa
MIWEVTKLRISMILSAIAILVLGFALIYGILGYFFGFSNAPLLITGALAFVTIFTILQWL
FGPALIKSIYHLTEVDPTDPQYGWVYNLVQEVAMYNRMNTPKVYIANVPFPNAFAFESPI
YGKNMAITLPLLRMLTPEEVKAVIGHEIGHLRHKDTELLLAVGLIPTLLYWIGYGLWWGG
LLGGGGGGRNDNSGILFLIGIALIAFSFLFNLFVLFLNRMREAYADVNSAITVPNGAKNL
QTALAKIVLSTDPDIIERYKKKYGQIGSMLLFSGFQINEDIPAYKVQELVEYWRNIKVSP
FADIFSDHPHPAKRIQLLEKLTHTQ
NT seq 978 nt   +upstreamnt  +downstreamnt
atgatttgggaagtaactaaattaagaataagtatgatactctcagcaattgcaatatta
gttctaggtttcgcattaatctacggcatattaggctacttcttcggcttctctaatgca
ccattacttattactggagctttagcgtttgtaacaatatttacaatacttcaatggtta
ttcgggccagctttaataaaatcaatttatcatcttactgaagtagaccctactgatcca
caatatggatgggtttataatctcgttcaagaggtcgctatgtataatagaatgaataca
ccaaaagtttacatagctaatgtaccatttccaaacgcttttgccttcgaaagccctatt
tatggtaagaacatggcaattacattgcctttattaagaatgttaactccggaagaagta
aaagcagttataggtcatgagataggtcaccttagacataaagatacagaattacttttg
gcagtggggcttattccaactctactctactggataggttacggattatggtggggtgga
ctgcttggtggaggtggaggaggtagaaacgataattctggaatcctattcttaatcgga
atagcattaatagcattcagcttcctgtttaatctatttgtactcttccttaatagaatg
agagaagcatacgctgacgttaactctgcaataacagtccctaatggtgctaagaatttg
caaacagcattagctaaaatcgtattatccacagatccagatataattgaaaggtataag
aaaaaatatggacaaataggaagtatgctattattctctggttttcaaataaacgaagat
ataccagcttataaagttcaagaattagtagaatattggagaaatataaaggtaagccca
tttgcagacatctttagcgatcatccacacccagcaaaaagaatacaattattagaaaaa
cttactcatactcaatag

DBGET integrated database retrieval system