KEGG   Sulfurisphaera tokodaii: STK_23520
Entry
STK_23520         CDS       T00062                                 

Definition
(GenBank) putative sugar-phosphate nucleotidyltransferase
Organism
sto  Sulfurisphaera tokodaii
SSDB
Motif
Pfam: NTP_transferase NTP_transf_3
Other DBs
NCBI-ProteinID: BAB67461
UniProt: Q96Y16
Position
2352731..2353507
AA seq 258 aa
MVNKAVITAAGKGSRMKYITSVLPKALLPLFRNEEGKIVMRPVIDLIMDSLQEVGVKKFC
IVVGKHGKLLMDYLFERGVTFVFQPEPKGFGDAVLRAEDFSNNDPFFVHADDGVLTGGYR
EANSLFEEIKPDAILLVREVSNPKRYGIVSVKEKGEYMGHKLYIVTQAEEKPLEPKSNLG
ISAVYVFSPKIFQSLKRITVEENNELELTYGIQKIIEDGGEVYAIKLEKEKWLNVGDPQS
YYDALMYSYKNLTTTFSI
NT seq 777 nt   +upstreamnt  +downstreamnt
atggtaaataaagctgtaattactgctgcaggtaaaggaagtaggatgaaatatataact
tcagtcttgcccaaagcattactacccttatttagaaatgaagaaggaaagattgtaatg
agaccagtgattgatttaataatggattcccttcaagaagttggagtaaagaaattttgt
attgttgtgggaaaacatggaaaacttttaatggattatcttttcgaaaggggggtaact
tttgttttccaaccagaacctaaaggctttggcgatgctgtattaagggctgaagacttc
tcaaataatgatccctttttcgtccatgctgatgatggtgtgttaactgggggttataga
gaagcaaattcgttgtttgaagaaataaagcctgatgctatccttctagttagagaagtt
agtaatcctaaaagatacggtatagtttcggtaaaagaaaaaggagagtatatgggccat
aagttatacattgttacacaagctgaagaaaaacctttagaacctaaaagtaatctagga
atatctgcagtatatgtcttttctcctaaaatatttcaaagtttaaaaaggataacagtt
gaagaaaataatgaattggaattaacatatggtattcagaaaataattgaggatggcgga
gaagtttatgccattaaactagaaaaagaaaaatggttgaatgtaggtgatcctcaaagt
tattatgatgcattaatgtattcttataaaaatttaactactacattctccatttag

DBGET integrated database retrieval system