KEGG   Sulfurisphaera tokodaii: STK_23620
Entry
STK_23620         CDS       T00062                                 
Name
(GenBank) hypothetical protein
Organism
sto  Sulfurisphaera tokodaii
SSDB
Motif
Pfam: Usp DUF2004 PNMA_N NAD_binding_7 PBECR3 GFD1
Other DBs
NCBI-ProteinID: BAB67472
UniProt: Q96Y05
Position
2363978..2364370
AA seq 130 aa
MKILVAYDGSDNSKKALFFILNLLRKEDEIYLVTVVKEAPKSPEQKIIQEREEAEEKQKQ
VLKDLEGYKVTTEILESPDVSSAIIEYCKKINCNMIVTGSRGLTGLKKVILGSVSSALVS
KADVPVLVVK
NT seq 393 nt   +upstreamnt  +downstreamnt
gtgaaaatcctagtagcttatgatggatcagataattcaaaaaaggcattattttttata
ctcaatctgttaaggaaggaggatgaaatatatctagttactgtggttaaggaagctcct
aaatcaccggaacaaaagattattcaagaacgagaggaagctgaagaaaaacagaaacaa
gttttgaaggatttagaagggtataaagtgactacagaaatattagaaagcccagatgtt
tcttcagcaataatagaatactgcaaaaaaattaactgtaatatgatagttaccggtagc
aggggtttaactggtttaaagaaggtaattttaggtagtgtttcatctgcacttgtaagt
aaggctgatgtaccggtattagttgtcaagtaa

DBGET integrated database retrieval system