KEGG   Sulfurisphaera tokodaii: STK_23940
Entry
STK_23940         CDS       T00062                                 
Name
(GenBank) probable sulfocyanin
Organism
sto  Sulfurisphaera tokodaii
SSDB
Motif
Pfam: SoxE Copper-bind SSP160
Other DBs
NCBI-ProteinID: BAK54797
UniProt: F9VPF0
Position
complement(2396410..2397063)
AA seq 217 aa
MNKLGVALLIIIFAGTAIMAGFIAYNFAMVTYPLPKSHAAIILTTTTTTTSTSTTTTSTT
STTTTSSLPPGAIALPYDASNHTVFLYLAALSTGNVFNFNGTSFGKMHVYIPAGWTVIVY
FTNEESGLPHNLLIVQNDTATPNSSDVGNDGKILLYVGTTPSSYTANGLISGQSASGSIT
LQPGYYWFCCGIAGHAVAGMWGVIIVSSSITVPYATT
NT seq 654 nt   +upstreamnt  +downstreamnt
atgaataagctaggagtagcattactaattataattttcgctggcacagcaatcatggcg
ggatttatcgcatataattttgctatggtaacttacccattacctaagtcacatgcagca
ataatactaactacaacaacaactaccacttctacttctacaactaccacttcaacaact
tctaccacaacaacttcgtccttacctcctggtgctatcgccttgccttatgatgctagt
aatcatactgtattcttatatttagctgccttgtctactggtaacgttttcaattttaat
ggaacttcttttggaaaaatgcacgtctacataccagctggttggactgtaatagtttat
ttcaccaatgaagaaagtggtctaccacacaacctcttgatagtacaaaatgacacggca
acaccaaatagctcagatgtaggaaacgatggaaaaatactactatatgtaggaacaaca
ccaagctcctacactgcaaatggattaataagcgggcaatcagctagtggatcaataaca
ctacaaccaggatactattggttctgctgtggaatagcaggacatgcagtagcgggcatg
tggggagtaataatagtctcatcttcaataacagtaccatatgcaacaacataa

DBGET integrated database retrieval system