KEGG   Sulfurisphaera tokodaii: STK_24460
Entry
STK_24460         CDS       T00062                                 
Name
(GenBank) putative ABC transporter ATP-binding protein
  KO
K01990  ABC-2 type transport system ATP-binding protein
Organism
sto  Sulfurisphaera tokodaii
Brite
KEGG Orthology (KO) [BR:sto00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sto02000]
    STK_24460
Transporters [BR:sto02000]
 ABC transporters, prokaryotic type
  ABC-2 type and other transporters
   ABC-2 type transporter
    STK_24460
SSDB
Motif
Pfam: ABC_tran AAA_21 nSTAND3 SMC_N AAA_15 NB-ARC AAA_22 MukB AAA AAA_29 AAA_13 TsaE PduV-EutP AAA_23 AAA_16 AAA_18 AAA_28
Other DBs
NCBI-ProteinID: BAB67556
UniProt: Q96XS1
Position
complement(2448326..2449156)
AA seq 276 aa
MIETINLTKIYKDGTIALDNVTFSSDVKILTLLGRNGAGKTTLTRILSTQLLPTKGEAYV
EGYNVIKEAKKIRKIITSIPQEAQPVGMASPYEHLLMFLTAKGLSLSESERVAREALKEV
GLWEVKDKPSDELSGGMKRKIFVAMALAANSEVIFLDEPTTGLDPYSRTEIWSILKTMKG
KIILTTHYMEEAEELSDEVILLHKGRIIAMGSVTTLLEKLKDKVRVEGIGDIKVGRLRIT
YVDKREASNFVGKYVVKPISLEDLFILYAGEGLEEN
NT seq 831 nt   +upstreamnt  +downstreamnt
gtgatagaaactattaatttaactaagatttacaaagatggaactattgcccttgataac
gtcacattttccagtgacgtgaagattttaacccttttaggaagaaatggagctggtaaa
actactctcacaaggattttatcaactcaacttttaccaactaaaggagaagcttacgtt
gaaggttataacgtaataaaagaagctaagaaaattagaaaaattattacttcaataccc
caagaggcgcaaccagtaggaatggcatccccttatgagcatttacttatgttcttaaca
gcaaaaggattatctctttcagaatctgaaagagtggctagagaggccctaaaagaagta
ggtttatgggaagtaaaagataaaccttctgacgagctatctggaggaatgaagagaaag
atctttgttgccatggcattagctgcaaattcagaagtaatatttcttgatgaacctaca
actggtttggatccatattctcgaactgaaatttggtcaatactaaagacaatgaaaggt
aaaattatattaactacccattatatggaagaagctgaagaactttcagatgaagttatc
cttttacataagggaagaattattgcgatgggaagtgttacaaccttgctagagaaatta
aaagataaagttagagtagagggtattggagatataaaagtaggtaggctaagaataact
tatgtagataagagagaagcatcaaactttgtaggaaaatatgttgtgaaaccaattagt
ttagaggatttatttatactgtatgcgggtgagggacttgaagaaaattga

DBGET integrated database retrieval system