KEGG   Sulfurisphaera tokodaii: STK_24840
Entry
STK_24840         CDS       T00062                                 
Name
(GenBank) putative oxidoreductase molybdopterin-binding subunit
  KO
K03520  aerobic carbon-monoxide dehydrogenase large subunit [EC:1.2.5.3]
Organism
sto  Sulfurisphaera tokodaii
Brite
KEGG Orthology (KO) [BR:sto00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    STK_24840
Enzymes [BR:sto01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.5  With a quinone or similar compound as acceptor
    1.2.5.3  aerobic carbon monoxide dehydrogenase
     STK_24840
SSDB
Motif
Pfam: MoCoBD_2 MoCoBD_1 Ald_Xan_dh_C
Other DBs
NCBI-ProteinID: BAB67592
UniProt: Q96XN5
Position
2485140..2487332
AA seq 730 aa
MYVGQRVKRKEDLKLITGSGRYIDDIEIPGNLYIAILRSSVAHAKLKKIEYSDVLKLNGV
YGVITGLTIPVENRPRNFPMAKDEILYMGQPIAAVLAKDRYVAVDALDYISYDYEELPAV
IDPEEAINSKVKAIEDYDNIIYKKTYSGGNAEEAYEKSDVKIEEKLVISRVYAAPMEPRG
LVVDYQQDRLTVYASTQSPHYMRSFLLSAFGDKVNDIRVIQADVGGAFGSKLFPYPEDYI
AVFAALTYKRPVKLVNTRRDDLFSTYHSRGQIHKVKVGASKDGKINSILDDLIIDLGAAW
HGTYLADIPATLITGPYDIKNAKVNVFGVLTNKTPLDQYRGAGRPEAAFVYERIMDIVAD
ELKIDPIELRRKNIIQSTPYKNVMGLTYDSGDYNALLTKAESYYREMEQRAEELRRQGKR
VGVGLSFYIEQNNFGPWESASVRLLSNGKVEVVIGAAPHGQGTATGIAQIVADELEISID
DVEVTWGDTDKISNAFGTYGSRSLTLAGNAALLASRKLKENIMKLAAQFMKSDVEELQYK
DGKVFNPKTGKSMTLKEIAIKVTSNLGGVWRYKAEPTLEATASFGFDNYTFPYGSHIAMV
EVTDEGVVKVLDYVAIDDIGVVVNPMLAEGQVHGGVIQGFGETLLEQIVYDNNGNLLTST
FADYLIPSAVESFNMKWFYTEIGKSNAPLPAKGIGEGATIGAPPALIRAIERAIGKRLTA
LPVKMEELSK
NT seq 2193 nt   +upstreamnt  +downstreamnt
gtgtacgtgggtcaacgcgttaaaaggaaggaagaccttaaattaataactggatctggt
agatatattgatgatatagaaattcctggaaatctttatatagcaattttaagaagtagt
gttgcccatgcaaaattaaagaaaatagagtatagtgacgtattaaaattgaacggtgtt
tatggagtaataaccggtttaacaattccagttgagaatagaccaagaaactttccaatg
gcaaaagacgaaatcttgtatatgggacaacctatagctgccgttctggctaaagatagg
tacgttgcggttgatgctctcgattatatttcatatgattatgaagaattgccagccgtt
atagacccagaagaagctataaatagtaaggtaaaagctatagaggattacgataatata
atttataagaagacttattctggtggaaatgccgaagaagcttatgaaaaatctgacgta
aaaattgaggagaaattagtaatttcaagggtttacgccgcaccgatggaacctagaggg
ttagtagtagattatcaacaagatagattaacagtatatgcctctacacaatctccacac
tatatgagatctttcttgctttcagcattcggagataaggtaaatgatattagagtgatt
caagcagatgttggaggtgcttttggttcaaaactattcccatatccagaagattatata
gctgtattcgccgcgttaacttataaaagaccagttaagctagtaaatactagaagagat
gacttattttcaacttatcattcgagaggtcaaattcacaaggttaaggttggtgcttct
aaggatggtaaaataaattccatattagatgatttaatcattgaccttggtgctgcttgg
catggtacatacttagctgatattccagcaactctaattaccggtccttatgacattaag
aatgctaaagttaatgtatttggtgttttaacaaacaaaacccctcttgaccaatacaga
ggtgctggaagacctgaagcagcatttgtttatgagaggataatggatattgttgctgat
gaactaaagattgatccaattgaattgaggagaaagaatataattcaatcgacaccttac
aagaacgtcatgggtttaacatacgatagcggcgattataatgctttacttactaaggct
gaaagttactatagggaaatggagcaaagagcggaagaattaagaagacaaggaaagaga
gttggtgttggtctttcattttatattgagcaaaataacttcggcccttgggaaagtgca
tcagttagacttctttccaatgggaaagttgaggttgtgataggtgctgcacctcatggt
caaggcacagcgactggaatagctcaaatagttgctgatgaattagaaattagtattgac
gatgttgaagtcacatggggtgacaccgataagatatccaatgcgtttggaacttatggt
agtagaagcctaacattagctggaaatgctgcacttcttgcaagtagaaaattaaaagaa
aatataatgaagttagctgcacaattcatgaagagtgatgttgaagaactgcaatataaa
gatggtaaagtatttaatcctaagactggtaaatcaatgacactgaaagaaatagctata
aaagttacaagcaatctaggtggagtttggaggtataaagcagaacctacattagaggct
acggcatcttttgggtttgataattataccttcccctatggttcacatatagctatggtt
gaagttactgatgaaggagtagttaaagttctagattatgttgctatagatgatattggt
gtcgttgttaatccaatgttagctgaaggtcaagtacacggtggagtaattcaaggattt
ggagaaaccttgctagagcaaattgtttatgataataacggtaatttattaacatcgacg
tttgcagattatctaattccctcagccgttgaatcgtttaacatgaaatggttctacaca
gaaattggtaaatctaacgcgccattaccagcaaaaggaataggtgaaggtgctacaatt
ggtgcaccaccagcgttaattagagctatagaaagggcaataggtaaaagattaactgcc
ttaccggtaaaaatggaagaattaagtaaataa

DBGET integrated database retrieval system