KEGG   Sulfurisphaera tokodaii: STK_24900
Entry
STK_24900         CDS       T00062                                 
Name
(GenBank) putative oxidoreductase molybdopterin-binding subunit
  KO
K03520  aerobic carbon-monoxide dehydrogenase large subunit [EC:1.2.5.3]
Organism
sto  Sulfurisphaera tokodaii
Brite
KEGG Orthology (KO) [BR:sto00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    STK_24900
Enzymes [BR:sto01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.5  With a quinone or similar compound as acceptor
    1.2.5.3  aerobic carbon monoxide dehydrogenase
     STK_24900
SSDB
Motif
Pfam: MoCoBD_1 MoCoBD_2 Ald_Xan_dh_C Nairo_nucleo
Other DBs
NCBI-ProteinID: BAB67598
UniProt: Q96XM9
Position
complement(2492063..2494120)
AA seq 685 aa
MLQEHLPIITGKSTYIDDINPKNVAYLHVVRSPIARGIIKSISKPQHALLTLTWDDVKTY
MPARLFPDLARTSQVARMPVLADGRVNFVGQPVLAFVVEDRYETEDVAEEVSIDYEELKP
VVDVEESLKEEPIHPGLKSNISIDQLLEGGDLSLKNRADVVVRRKIKQHRIVSNPMEPKG
IICWWDNDVLNVYVSTQAPFGVRNDLREVLGIPPEKIRVYSPPNVGGGFGNKSGGYPEYV
LAAIASLKLGRPIKWIETRSEMLVNTQSLGRGEVSDMKLYATKDGEILGMEGTIIANIGA
YDYGLNFFTSLFVARLSNGPYKLKFASIRAMSVFTNTPPMGFYRGAGRPEAALIHETLVE
DLAEELGMDPVEIRRKNLIDDNGYLTPLGSRLDPAGYHEVLDKAEKYYRKAKEVYKDKGI
SLVVFTEIVRTSPGEGAKVEIKNGKVYFSLGLGPHGQAYSSTFKKLASQALGIDESMIEV
VTGSTETVKEGIGSFGSRAGTIGGSAVIAASKELLKKLGKDSLNGEDLIKYEGVSAEVFY
KADDIFAPGAHVAVVDLDKETGFAKIIDYYAVDDVGKVLNKEEIEGQIIGGILQGASQVV
IEAMRYDERGIPLCASIADCGVPTSLEAPLNISQEYVEYPSQLLSGSRGVGEAGTTGALP
AVFIAFEKAAKKKFNITPIDPWIIV
NT seq 2058 nt   +upstreamnt  +downstreamnt
atgcttcaagagcatttaccaataataactggtaaatccacttatatagatgatattaat
ccaaaaaacgttgcatatcttcacgttgttagatcgccaatagctaggggtataataaaa
agtatatctaagccacaacatgcgttattaaccttaacatgggatgacgttaaaacctat
atgcccgcgaggctatttccagatctagctagaacttcacaagtagctagaatgccagta
ttagctgatggaagagtcaactttgtcggacaaccagttttagcatttgttgttgaggac
agatatgaaacagaggatgtagcagaagaagtttcgatagattacgaagaacttaaacca
gtagtggacgtagaggaatcattaaaagaagaacctatacatccaggattaaagagtaat
atttcaatagatcagctactagaaggaggagatttatcccttaagaatagggcagatgta
gtagtcagaagaaaaataaaacaacatagaattgtttcaaatccaatggaacctaaagga
ataatctgttggtgggataatgatgtattaaacgtatatgtttctacacaagctcctttt
ggagtaagaaatgatttaagggaagtcttaggtatacctccagagaaaattagagtttac
tctccacctaatgtaggaggcggatttggtaataaaagtggaggttacccagaatatgta
ttagctgcaatagcttcgttaaaattaggtagacctattaaatggattgagaccagaagt
gaaatgttagtaaatactcaatcactaggtagaggagaagtttctgacatgaagttatat
gctactaaagatggagaaatattaggtatggaaggaacaataatagctaacataggtgcc
tacgattacggtttaaatttctttacatcattgtttgtagcaaggttatctaatggtcct
tataaattaaagtttgcctcgatcagagctatgtcggtatttactaacacaccacctatg
ggattctatagaggagctggaagaccagaagcagcgttaattcacgaaacactggttgag
gatttggctgaagaattaggaatggatcccgtagaaataaggaggaagaaccttatagat
gataacggttatctaacacctttaggtagtagattagatcctgcaggatatcatgaagtt
ttagacaaagcagaaaaatattataggaaagcaaaagaagtatacaaggataaaggaata
tcattagtagtatttaccgaaatagtaagaacatcaccgggtgagggagctaaagttgaa
attaagaacgggaaagtgtacttcagtttaggcttaggtcctcatggtcaagcttatagt
agtacgtttaaaaaattagcttcgcaggctttagggattgatgagagtatgatagaagta
gttacgggaagtactgaaaccgtaaaagaaggtatagggagttttggctctagagcggga
acaataggagggtcagcagtaattgctgcttctaaagaattattgaaaaaactaggtaaa
gattcgctgaatggagaagatttaataaagtatgaaggagtaagtgctgaggtattttac
aaagctgatgatattttcgcaccaggtgctcatgtagcagttgtagacttagataaggag
acaggcttcgctaaaattatagattattacgcagtagatgatgtgggtaaagttcttaat
aaagaagaaattgaagggcagattattggaggaattttacaaggagcttcccaagttgta
attgaagcaatgagatatgatgaacgaggaattccattatgtgcttcgatagcagattgt
ggagtacctacttctcttgaagcaccactaaatataagtcaagaatacgtagaatatcct
tctcaactattatctggaagtagaggagtaggtgaagctggaactactggagccttacca
gcagtattcatagcctttgaaaaagcagctaagaaaaagtttaacataacaccaatcgac
ccatggattattgtataa

DBGET integrated database retrieval system