KEGG   Sulfolobus tokodaii: STK_25290Help
Entry
STK_25290         CDS       T00062                                 

Definition
(GenBank) putative glycosidase
Organism
sto  Sulfolobus tokodaii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF608 Glyco_hydr_116N
Motif
Other DBs
NCBI-ProteinID: BAB67642
UniProt: Q96XI5
Position
2536953..2539463
Genome map
AA seq 836 aa AA seqDB search
MKYLYSYALDSGVVLGGIGTGSIEIRADGRLYDWTIFNNGSYAERQEIRRVYYLTQNDFF
TGIRYGNKVRILQAYDYYFGASPYYTPWLRPVKSLEYMGEPPFAFLNFKDDFEVKLRAFS
PFIPHDLKNSSLPVAIFEYEVDKDSDFIVGIRNPFESGRIEFKRDTLVFSGEVTSKDPRY
GGNLCIKVVRSPWLAKGDNFPLFKEWNEFREKGYISTNQGDKWGFIGNKNKKFTVILGWY
FPNHLTANGKNIGHYYENFFNNCLDVVNYAEENLIYLEKMTNEFHDALYNTRGVENWIAD
LVGSQLTTLIKSTWLSKDGNFYIWEGYYQTSDERKVGEHPYTDGPVNTALNTIDVSTYFI
YTLTVLYPQLAKNLLLTSSRSALSYDNPLYIFYSLAMPENRSKYVERVIKDPSIPSSIEK
LLQTVKEIAKETGKDPKGRIAHYIYRDLKFDEYGRNDLNPEFVLMWGLVSKYTGDIEFMK
SLYPVAKEAMESVLRTHSYEGLIYSRLPSGFEWNRQVFSYFKDVNIYDNLFLVVSLLGID
SFHMSVNTFDDWTTIGINSFVSLLGISALKILNELGGDKYNVENALSLYESMLWNGEYFD
LWYDPISGYRDKTCQASQLLGEFYLNLLGYSLLDREKTRKTLLSIVKYNLKEEEGVINGA
YPDGYRPLMREYENPLKIKEASIHQDTPWSGVEFYLASHLIYEKMIDEAKKVLKEVYDRY
SIAGNFWNHWEWGSHYSRPLSSWLIIPAYLGLIYDGVNRVLTLDPAIEELSWIIVLPDFW
GRINVNKEKTEIKIIEGKAVLKKIDIKGKKITRIVADGKVVDGDIIAEKEIIVEYE
NT seq 2511 nt NT seq  +upstreamnt  +downstreamnt
atgaaatacttgtattcttatgctctggactctggagtcgtgttaggtggtataggtact
ggatctatagaaataagagctgatgggaggttgtatgattggacaatattcaataatggt
agttatgctgaaagacaagagattagaagggtttattatctcactcaaaacgatttcttt
actggaataagatatggaaataaggtgaggattctccaggcttatgattattattttggt
gcaagcccctattacacaccatggttaagacctgtaaagagtttagaatatatgggagaa
ccgccttttgcattcttaaactttaaggatgattttgaagttaaactaagagcattttca
cctttcataccgcatgaccttaagaattcctccttgccagttgcaatatttgaatatgag
gttgataaggattcagattttatagtaggtataagaaatccatttgaaagcggtagaatc
gagtttaagagggatactttagttttttctggtgaggttacctctaaggatcctagatat
ggtggtaatttatgtataaaggttgttagaagtccatggcttgcaaagggagataacttt
cctctatttaaggagtggaatgaatttagagaaaagggatatatttccactaatcaaggt
gataaatggggttttattggtaataagaataagaagtttactgtaatactaggctggtat
tttccaaatcacttaactgctaacggcaaaaacataggccattattatgaaaacttcttt
aataactgtcttgatgtcgtaaattatgctgaggaaaatcttatctatctagaaaaaatg
actaacgagtttcatgatgctctttataatactcgaggagttgagaattggatagctgat
ttggttggatcccagttgacaactcttattaaatctacatggttgtcgaaagatggtaat
ttctatatctgggaaggatattatcagacctcagatgaaagaaaggttggtgagcatcca
tatactgatgggccagttaatactgcgttaaataccatcgatgtttccacgtactttatt
tatactcttacagtattatatccacaattagcaaagaatttgcttttaacctcttctagg
agtgcattaagttacgataaccctctatatattttttactcattagcaatgccagagaat
agatcaaaatatgtagagagagtgattaaagatccctctattccctcttctatcgaaaag
cttttgcaaactgtaaaagagatagctaaggaaactggaaaagatcccaagggaagaatt
gctcattatatatatagagatttaaaatttgatgaatatggtaggaacgatttaaatcca
gaatttgtactaatgtggggtttagtttctaaatatactggcgatattgaatttatgaaa
tccttatatcctgtagcaaaagaggctatggaaagtgttttaaggactcattcttatgaa
ggtttaatttatagtagattacctagtggttttgagtggaatagacaagtgttttcttat
tttaaggacgttaatatttatgataatctcttcttagttgtctctttattaggtatagat
tcctttcacatgagtgttaacacttttgatgattggactacaattggtattaactctttt
gtttctcttctaggtatttcggctttgaaaatactaaacgagttaggaggagataaatat
aatgttgaaaacgctctctcactttatgagtctatgctttggaatggcgaatattttgac
ctatggtatgatccaatatctggatatagggataaaacttgtcaagcttcacaactatta
ggcgaattttatttaaacttattaggttattctcttctagatagagagaagacaaggaaa
actctactatctattgtcaaatacaatttgaaagaagaggaaggagtgattaatggtgct
tatccagatggttataggcctttaatgagggaatatgaaaatccattaaagattaaagaa
gctagcattcatcaagatactccttggagtggtgttgagttttacttagcctctcactta
atttatgagaaaatgattgatgaggctaagaaagtgttaaaggaagtttatgatagatat
tctattgctggcaacttctggaatcattgggagtggggttcacattattcaagacctcta
tcctcatggctaataattccagcatatttaggacttatttatgatggtgttaacagagtc
cttactttagatcctgcaatcgaggaattatcgtggataattgttttgccagacttttgg
ggaaggattaatgtaaataaggaaaagacagaaattaagattattgagggtaaagctgtt
ttaaagaagattgatattaaaggtaagaagattacaagaatagtcgctgatgggaaagtt
gttgatggggatattattgctgagaaggagataattgttgaatatgagtaa

DBGET integrated database retrieval system