KEGG   Sulfurisphaera tokodaii: STK_25560
Entry
STK_25560         CDS       T00062                                 
Name
(GenBank) oxidoreductase
Organism
sto  Sulfurisphaera tokodaii
SSDB
Motif
Pfam: adh_short_C2 adh_short KR Epimerase NAD_binding_10 2-Hacid_dh_C THF_DHG_CYH_C DUF1776 Oxidored_nitro GDP_Man_Dehyd
Other DBs
NCBI-ProteinID: BAB67668
UniProt: Q96XG0
Position
complement(2567749..2568510)
AA seq 253 aa
MEISLKGKTCLITGGTHGIGLATAKLFAELGAKVIALGRNIESVEKENNSIQFVKVDLTS
REQLLSFIELYKKEIGIIDCLINNASTNSRYSILNVTLEEWDKMISLVLTAPMLLSKMAA
ELMIKNGIKGKIINIAAIQAHYPLPESLPYVTVKGGLIAMTKSLAVDLGKYGIQVIAVVP
GPIYTKGEKVPENLDKNAATLLGRMGRPQEVANLLAFLASDYNTFITGTEIIIDGGRIIS
RKPDPEEITSGAV
NT seq 762 nt   +upstreamnt  +downstreamnt
atggaaatatctctcaaaggtaaaacatgtctaattactggaggtactcacggaatagga
ttggccacagcaaaactatttgctgagcttggtgcaaaagtaatagctttagggagaaat
attgaatcagtcgaaaaagagaacaatagtattcaatttgttaaagtagatttaacttct
agggaacaactcctctcatttatagagttgtataaaaaggaaataggaattatagattgt
ctaattaataatgcttcaactaattctagatattctatactcaatgttacattagaagag
tgggataagatgatatctttagtacttactgcccctatgttactttcaaaaatggcagct
gaacttatgataaaaaatggtattaaaggtaaaataataaacatagctgctatacaagct
cactacccattgccggaatccttaccttacgttacagttaagggaggtcttatagctatg
accaaaagtcttgctgtagatttaggaaaatatggaattcaagttattgcggttgtcccg
ggacctatatatactaaaggtgaaaaagtcccagaaaatctagataaaaatgcagctaca
cttctcggaagaatgggcaggcctcaagaagttgctaatttgttagcttttctagcctca
gattacaatacattcataactggaactgagataatcatagatggagggagaataataagc
agaaagccagatccagaagaaattacttctggtgcggtatga

DBGET integrated database retrieval system