KEGG   Sulfurisphaera tokodaii: STK_25620
Entry
STK_25620         CDS       T00062                                 
Name
(GenBank) putative GntR family transcriptional regulator
Organism
sto  Sulfurisphaera tokodaii
SSDB
Motif
Pfam: FCD GntR HTH_24 HTH_11 FadR_C HTH_Crp_2 TRF TrmB Prefoldin MCM_C Phage_rep_O HTH_54 Fe_dep_repress MarR TFIIE_alpha Rrf2 PaaX HTH_27 RPA_C
Other DBs
NCBI-ProteinID: BAB67673
UniProt: Q96XF5
Position
2573033..2573674
AA seq 213 aa
MSLSQLAYEKILNLIINGKYKPGNLLKEDELANTLNISRTPVREALARLERDGIIIKSGK
SYSVIPLSAEDIIQIYEIRIPLEAEASKLASIRGTEEELKKMLDIIEEIKRVKEDAEPLT
LAELNGKLHRTISEASHNKFLADILENIRLKLKIVRVTLFTSFQRREEELREHSEIVTAI
IERNPDKAYQLMKEHELNVLEYVKKNILPILFR
NT seq 642 nt   +upstreamnt  +downstreamnt
gtgtctttatcacaattggcatatgaaaagatcttgaatttaattataaacggcaagtat
aaaccagggaatttgcttaaggaagatgaattggcaaacactcttaatattagtaggaca
cctgttagagaagctttagctagattagagagggatggtattataataaaatctgggaag
tcgtattctgttattcctttatcagcagaagatataattcaaatttatgaaattaggatt
cctttagaggctgaagcaagtaagttagcttctattaggggtactgaggaggagttaaag
aaaatgttagacattatagaagagataaaaagagttaaggaggatgcagaacctttgact
ttagctgaactcaatggaaaacttcatagaactataagtgaagcttcccataataaattt
ctggctgatatattagagaatataagattaaaattaaagatagttagggtaacacttttt
actagttttcagaggagagaagaagaattaagagaacacagtgaaattgttacggctatt
atagagaggaatccagataaagcttatcaacttatgaaggaacatgaactaaatgttcta
gaatatgtaaaaaagaatattttaccaatactctttagatga

DBGET integrated database retrieval system