KEGG   Sulfurisphaera tokodaii: STK_25730
Entry
STK_25730         CDS       T00062                                 
Name
(GenBank) hypothetical protein
  KO
K03885  NADH:quinone reductase (non-electrogenic) [EC:1.6.5.9]
Organism
sto  Sulfurisphaera tokodaii
Pathway
sto00190  Oxidative phosphorylation
sto01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sto00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    STK_25730
Enzymes [BR:sto01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.5  With a quinone or similar compound as acceptor
    1.6.5.9  NADH:quinone reductase (non-electrogenic)
     STK_25730
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox Pyr_redox_3 DAO AlaDh_PNT_C NAD_binding_8 3HCDH_N GIDA HI0933_like NAD_Gly3P_dh_N TrkA_N FAD_binding_3
Other DBs
NCBI-ProteinID: BAB67684
UniProt: Q96XE4
Position
complement(2586152..2587177)
AA seq 341 aa
MKVVILGGGFAGISAKLSYPNSILIDENDFVVNTPKLVEVIENVDLEISHALIHRKVDLK
AKVLKVDFKEKEVITTEGKVKFDKLIISLGYEQDLSKIKGAEKYAIGFTIQNIEKIRKFR
EGSTVTILGGGALGIELAGALKKRGFNVNLIEAEKRLVPYLSSNFSTEVQKALEELGVNI
ILNGKVDEVKENEVITSQGVIKTDYTIFSAGFSGPKIIKELGLTNKNNRMLVDEYLRSVD
YDFVYGAGDCANFKNGFIPQSAQVASQAGSVAIKNAVEDDNIVFKPNQKAIVLKVGDEYI
GLFKDSVIKGALSKLVKIYAINSFENKISRLNTLPFHYLQI
NT seq 1026 nt   +upstreamnt  +downstreamnt
atgaaagttgtaatcttaggcggaggatttgctggaatatcagctaaattatcttatcct
aactcaatactaatagatgaaaatgatttcgtagttaatactcctaaattggttgaagtt
atagagaatgttgacttagaaatttctcatgcattaattcatagaaaggtcgatcttaag
gctaaggttttaaaggtagattttaaggagaaagaagttattacgactgaaggaaaggtt
aagtttgacaaattaataatatccttaggttatgagcaagacctaagtaagataaaggga
gctgagaagtatgcaattggatttaccatacaaaacatagagaaaataagaaaatttaga
gaggggtcaactgtaactatactcggaggaggtgctttaggcatcgaattggctggggct
ttgaagaagaggggttttaacgttaatctgatagaagcagaaaagagattagtaccttat
ttatcctctaacttttctacagaagtacagaaggctttagaggaattaggggtaaacatt
atcttaaatgggaaagttgatgaggttaaggaaaacgaagttattacgagccaaggagta
ataaagacagactatacaatattttcagccggatttagtggtcctaagataataaaagaa
ctaggattaacaaataagaataatagaatgttagttgatgagtatttaaggtctgttgat
tatgattttgtttatggtgcaggagattgtgcgaattttaagaacggttttattcctcaa
tcagcccaagtagcttctcaagctggaagtgtagcaataaagaatgctgtagaagatgat
aatatcgttttcaaacccaatcaaaaggctatagttttaaaagttggtgatgaatatata
ggattattcaaggatagcgttataaagggtgctttatcgaaattggtgaagatttatgcg
ataaatagttttgaaaataaaatctctagactaaacactctgccttttcattatcttcaa
atctag

DBGET integrated database retrieval system