KEGG   Sulfurisphaera tokodaii: STK_26050
Entry
STK_26050         CDS       T00062                                 
Name
(GenBank) putative NAD-dependent alcohol dehydrogenase
Organism
sto  Sulfurisphaera tokodaii
SSDB
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 ADH_N_2 SIS_2 PALP ELFV_dehydrog
Other DBs
NCBI-ProteinID: BAB67719
UniProt: Q96XA9
Position
2621717..2622709
AA seq 330 aa
MKALVFDKSGIENLKYTDYEDPKIGPNEVLIRVRYAGVNPVDYYTVTRLNVKPLPHIPGV
EFAGEVEKVGERVTKVKPGDRVTIYGRIFDGTCDMCMIGYETLCRNGGRIGVDANGGWAE
YIAVEEKYVFKLPSEFSWELGSSMTVSALTAYHALKEANLKPGEVLVVFGASGNTGMFAV
QLGKKFGAKVIAVSRKSWLKDFGADLVVGYDEVEEKVKEFTNGKMADVVIDSLGGKLWNK
GFSVVGVKGRIVTFGTLLGAEVSLNLSELYSKHISILGVNRGNRKDFVELLELCKDCKVK
THKTYKLEEGKEALQELFNEKRDGRIFLST
NT seq 993 nt   +upstreamnt  +downstreamnt
gtgaaggcattagtttttgataaaagcggaatagaaaaccttaagtatacggattatgaa
gacccaaaaataggtccaaacgaagttctaattagggtaagatatgctggagtaaatcca
gtagattattatactgtaacacggcttaatgtaaaaccacttcctcatataccgggtgta
gagtttgctggagaagttgaaaaagtaggtgaaagagtaactaaggttaaacctggtgat
agagttacaatctacggtagaatatttgacggtacttgcgatatgtgtatgattggttat
gaaactctatgtagaaatggtggaaggataggagtagatgctaatggtggctgggctgaa
tatattgcagttgaggaaaagtatgtgtttaaattacctagtgagttttcatgggagtta
ggaagtagtatgactgtttcagctttaactgcttatcatgcattaaaagaggctaattta
aagcctggagaggttttagtagtttttggagcatccggaaatactggaatgtttgcggta
caattaggtaagaaatttggtgctaaagttattgctgtaagtaggaagagttggttaaag
gatttcggtgcagatctagttgttggatatgatgaagttgaagagaaagtgaaagagttt
actaacggaaaaatggctgatgttgtaattgattccttaggagggaagttatggaataag
ggattttctgttgttggtgtgaagggaagaatagtaacttttgggactcttttaggtgct
gaggtcagcttaaatctatctgaactttattctaaacacatctcgatattgggagttaac
agggggaataggaaggatttcgttgaactacttgaattatgtaaagattgtaaagtaaaa
actcacaaaacttacaaacttgaagagggtaaagaagccttacaagaattgtttaacgag
aagagggatggaagaattttcctctcaacttaa

DBGET integrated database retrieval system