KEGG   Salinispora tropica: Strop_0391Help
Entry
Strop_0391        CDS       T00504                                 

Definition
(GenBank) Alcohol dehydrogenase GroES domain protein
  KO
K22969  glucose 1-dehydrogenase [EC:1.1.1.47]
Organism
stp  Salinispora tropica
Pathway
stp00030  Pentose phosphate pathway
stp01100  Metabolic pathways
stp01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:stp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Strop_0391
Enzymes [BR:stp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.47  glucose 1-dehydrogenase [NAD(P)+]
     Strop_0391
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glu_dehyd_C ADH_N ADH_zinc_N FAD_binding_3 HI0933_like NAD_binding_8 Pyr_redox_3 Pyr_redox_2 DAO AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: ABP52876
UniProt: A4X1X6
Position
complement(451061..452107)
Genome map
AA seq 348 aa AA seqDB search
MRAVTVSPRIPGSLCLVEDWPEPAVEEGGILVEALAVGVCGTDQDIIAGHFGEAPPGQEQ
LVIGHESLGRVLEDPTGTLHRGDLVAAIVRHPDPVPCLNCAVDEWDMCRNGLFTEHGIKG
LPGFARERWRVQPRFAVPLGAAFARVGMLLEPTSIVAKAWEHIERVGHRARWDPRTTLIT
GAGPIGLLAALLATQRGLTVHVLDRNTTGPKPDLVRALGATYHTESVNEVDLQPDVLVEC
TGDPRVVLDSMCKVGPTGIVCLTGMSTGGRTIDFDAGALNRTLVLENTVVIGSVNSNRRH
WEQAAAALARADHSWLDALITHRIPMSDFTTAYEVNDGTIKVVLDLTA
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgcggtgacggtttctccccgaatccccggctcgctctgcctggtcgaggactgg
cccgagccggctgtcgaggagggcgggatcctggtcgaggcgctggcggtgggggtctgc
gggaccgaccaggacattatcgccggccatttcggcgaggcaccccccggccaggagcag
ctggtcatcgggcacgagtcgctcggccgggtgttggaggacccgacgggcaccctgcac
cgcggggacctggtggccgcgatcgtgcggcatcccgacccagtgccctgcctgaactgc
gccgtggacgagtgggacatgtgtcgcaacgggctgttcaccgagcacggcatcaaaggg
ctccccggcttcgcgcgggaacggtggcgggtgcagccgaggttcgcggtgccgctcggt
gccgccttcgcccgggtggggatgctgctggaacccaccagcatcgtcgccaaggcgtgg
gaacacatcgagcgggtcggccaccgcgcccgctgggacccacggaccaccctgatcacc
ggtgccgggccgatcggcctgctcgccgcgctgctcgccacccaacgtggactgaccgtg
cacgtactggaccgaaacacgacggggccgaagccggacctggtccgagcgctcggtgcc
acgtaccacaccgagtcggtcaacgaggtggacctccagccggatgtgctggtggagtgc
actggcgacccgagggtggtgctggactcgatgtgcaaggttggcccgaccggcatcgtc
tgcctgaccggcatgtccaccggtggtcggaccatcgacttcgacgccggggcgctgaac
cgaacgctcgtgttggagaacaccgtggtcatcgggtcggtcaactccaaccgccggcac
tgggaacaggccgcggcggcgctggcccgggccgatcactcgtggctggacgccctgatc
acccaccggataccgatgtccgacttcacaaccgcgtacgaggtcaacgacgggaccatc
aaggtggtcctggacctcaccgcctga

DBGET integrated database retrieval system