KEGG   Salinispora tropica: Strop_0483
Entry
Strop_0483        CDS       T00504                                 

Definition
(GenBank) hypothetical protein
Organism
stp  Salinispora tropica
SSDB
Motif
Pfam: Gln_amidase YwqJ-deaminase Peptidase_C2 WXG100 DUF677
Other DBs
NCBI-ProteinID: ABP52968
UniProt: A4X268
Position
548035..559299
AA seq 3754 aa
MAVPYPRDLIAEYPTVWNAVCWVSAGEAWPTGDEDQMRELAEAWKGLAETINDALLEADP
AVLKILQNWGGDSGEAFGQLWNQLAIDPGAGLPLIQEAAAAFAHGAENAAMEIEYAKLTI
LIAFLITVISVFVALLMAWLGGVSAAGIPAILAAGRQAVTVAVRRLVAQMGRQLFTRAGM
HAALRNVGMQVGQRLTREGLGHAGRRFALELAEEVSEELIIDVTAQAYQINAGTRAEWDV
RRTGTAALGGAFGAVLGTGLKAGTRFARNNLAPRMPISFSPPAVDFPGAGIARWGGRTLA
AGTQNAIVSPAASVLANRVMTGEWSMPGGDAVLGGFASGAGRGGATMAASSGGSALAHLH
NKLAGLDPSAVKGAGLDTGPSNLPTTGLGSISLAPPPAFDPASLDGAGQVGVGADAVAGS
VSPSSMAGDPQGGSSKHDGSIVVGQSAAPTIHSALSPFADGSVGDDSTADSAQHAPISPD
SEPAVVPVVASSAPAAVGPTAGLLPTTPATGGAVANPTVAGTPALATAQSSPAVSPSGST
SGTSASVAGGSSQTGSPQTAAGPGTQTGTRTPPASGPPVPTGNPRAPNSAGSVSLGPATT
PTASVPTSKLTPTVPAATGASPSTTPDPANRVPTQRVSVDGAMPASAPSHTGAPTTGTPD
SPIGGNETSVPTEARRSTGPTGGNTHSWQGKSFTVTGDPNGREAKRTLIEASRRLAEAVR
TAVKGKAISKGKMPGMAGALMMPNGEVTTHTSMTADKGTKPPTQPAVHPVVQDVLDRIKA
DLEAKHGEGAGHGKCAEVALVSDQIYRLEEEWRQAGEPGALEQYALNALSGAKVVTHQVR
TGWDEAGVKHDLGHYRLPCRSCRSLLPQFGIDPLSDPERSPKVYQPPVPGVVGNGRPLSD
ERPYGEPEGLVPPEPAHQQALDDAVPRDPETGRPEVHPDPRLRSWVGKVNDGGPTVPGRD
RNCADVGLSFLSTWFGRPEVAAATIEGADLEHASTARQEQALGSAFSYRGTGPSGLDDIA
VTLQGAGHGSAALIVTTSTKADGRAHTWNVVNHQGLIVWVDGQAGLVSDAGPFRSAGIGD
VWSITLDAEGDPLPPGQPQSDTDAPATEPVPVPPHSTAPAEGQRPDDSVGGRAAGISEQS
WGAENDYLGALSDAERATLFDELAAARSEATHILGELQSLAAGVNARLGLTGADALRTLG
EEHRVKGAESLARKYRTTLATLGYDIGSALATVNDVVRFSLRGPESELYGPAVDNVLASL
EERGYQVTNLKNFWRSGNRFFGLNCTLVSPGGRTFELQFPTATSYAIGKQTHVPYEVVRD
PAQPAADRVHAFLDILAINKSQGAAARMPGGMEAVRFGEANDSSFAKWIGASKRARLRKE
YLDWLGQQPYAFADVCVERGLTASDLPGLDRDLIGETHGDADIRLLPPAAGPGRPAGQPD
RERRHHGPDAGGDLGSVDRRVDVPSGRGGGVSVGGPGDGRGPGGGSGHRGTGDGSLHDGS
VADGSGVDRDLSRGVAEVAPGRPEVAGPELLSVEPETNYGLPETRSMGPGKLAPLEDPRY
QQDVALSLRTAEGYTYLADPFTHPYGRLINDGGPAEQGRGNNCLDCSLAALSSFYGDPQV
AQPRWPDIRVGGSFETELGEDSGLTRAEEWLGGIWAGGSAGLPAAPTARAAAVSDQYARL
YQRVAQSGPGSAALVVADWLGADDVTGELILDEEGGVTPDGAHAFILVYPSGVDRPVWWD
PQHGVAMPEPPPAYVARTYALWSMMVPSGGGTNDGGRGTSADHSSAGDPKSGPAGRVRVR
LGGSGGTLGGGASLGKARGSGAIHHRPDGRGDSPLEPAAPADSSAVRGSPPPRPLHGTTG
LAEGGPAGLNPTDTESAATSVVPPLTAADVAELATVTHQLRTANTFSRVAVRRELTATVD
RLGLRDGMLGAEQRMATLPAEVRAALAEVINQGSAHTSERSRLRPDRRTSEAKERPVGLP
RMRTYVGTHLTVNSLLLTLATTFTLNAGGRPELALMLGAGAFVGAVTTGPTKWLAKRAGL
AAEDRRARYDARQDARTAAEEDVATAAVLVAHTDDVTSTVQKLGAATTGLDGQVSAVQEQ
LRRDERRHRVMGPPRRFPSAGEDAPAVSDDSPGTGTSSAGAPGGSTAVGLTSRERERLAE
LRSLVARHDGARPWARFGVGREIRALLNSLGLRQGTPGVDHRRDLVPPDVRPLVERFGGS
RTAVVRARARAVIDRYPADDQRPGTVAPWWMSAVENAPNLLTATTVAGVGDLLGQLRLGW
FGIAGALAAAATGVAVDPVVARREAVAKDARDTWDADNPAVPAEALLSQAAEAVADPISA
VADRAATAVRRTADLEQRLADLERRVTDSQRRNGLIDSFRRLLFGDPAWAGLPPSKDATP
ISKDATPASRASADPEASTDPAAEPSVGSRDPASLQQLAELAVRHGSVGPLARPSVARQL
RFLIDRLGLREGTPGADQRRAQVPDELRPVVERHGQLGVTSRVITRFSRPPALATDSTER
PSNMRSLRVFAVEQTLGPLVQAGTWVGVAQVSQIAAGAGPSKILAGGLLGPLRDLLLNRA
ETRVKDARRAWDLANPNPAMEPKTRAAGLAGPSATAVTSAVGQLDVASRRLDDITSTLDR
LAQGHAAGPSDPAATPGIGEPLDVAGPASLNRADAWELQTAAHQVRTADALSLRPALREL
HAVIDRLGLRAGMLGAPDRIAQLPGVARRVVAEFGGDRAGRARQLRTLRAQRRTAENTRP
PGIPGLRTYLVSSGLTTAATAGAATAVAIAVASPLTPVIPIAAAVAAPVIGVSKWYARRR
GLAADDVRSRFDARVDARGAADQVDQVVDRVNEPVAELERAANRLEGQLGAAESATDRLA
ERLAETHRRVGLLSRLFDIVGWGPTAPTGSNPEAGAVRESRGSPEDSPESGRITAAAVPN
SGFHGLGRPVADPVAVLATAHAALPQVASYAGVDDIGPTGPNRFEIYAAGRFSFRVWLTT
GPLTDGVVAQTTRNSDGSFTVTVSDRAVDGVVARALTHEIAELAALHDSRQILIGPLDPG
TDDGLINPAGLTAHDQGRMAEIRLLAAEYEFAGPPTRLALRVEIDALANHLGLRLGDPAA
PGRAAIIPRDVHAQLMRLSTPSVTQESVAEVLDGSPATEVEQRRWVDYRNQLVPDSQVPS
TTELQARLHELAIQGEREQVSLPRMSAHAGQILHLPPAQLGLIRDVHPTLADRIAAEGVY
VDLAGRFDLRPYALTDAPEFSLAESRSAFDLGAEVGRQSLLAEDRARGYVVIRAAFGARS
AAMAMLHTHDLHYLTNARKLALVPGVLARALYALVPGAPPLDLEVTPTATAAEVTVIADR
VTLPAGESGEPAPEYGRPRDLWTGQPAPLFDGPPKREQVQQGKLGDCGMLASMAAVAGHR
PEAIAQLFQPNPDGTVDVLLHESTLLGDSIGPTGRRLRITVHPDVPIWDSVSGESAYADQ
SVIGSSWASLLEKALAAVDRTWSSDRHQQWQLTWAAWESPNDPLVAAPTGYARLDVGSHR
QMQAELLTQLTGLPSRAASFDQTPGRETASEARLAALLAAGSPVITATRGEDQYPAAIRN
QLPHGLVAGHAYEVVAVGNGQVQLHNPWNTRHPTPMTVREFLDLMNESFAYLEPPPTPPV
QSSDPHTLGRTWLEELGYSIAYYALLAADGTVSGLVVSESSRRGQRTRHWMAAGAPSAPG
SALPVDRTEAERIAREALGFTLPDEPALHDMLEG
NT seq 11265 nt   +upstreamnt  +downstreamnt
gtggcggtgccttaccccagggacctgatcgccgagtatcccacggtgtggaacgccgtc
tgttgggtcagcgccggtgaggcgtggcccaccggcgacgaggaccagatgcgtgagctc
gccgaggcgtggaagggcctcgctgagacgatcaatgatgctctccttgaggccgacccg
gctgtattgaagatcctccagaactggggcggagactccggggaggcgttcggccagctc
tggaaccagcttgccatcgatccgggcgcgggcctgccattgatccaagaggccgccgcc
gctttcgcccacggggccgagaacgccgcgatggagatcgagtatgcgaagctgaccatt
ctcatcgctttcctgatcacggtgatctctgtcttcgtcgcgttgctgatggcctggctg
ggtggggtgtcggcggcgggtatccccgccattctggctgctggccgacaggccgtgacg
gtcgcggtccggcgactggtcgcacagatgggccggcagctcttcacccgtgccgggatg
catgccgctctgcgtaacgttggcatgcaggtcggccagcggctaacccgggaagggctg
ggtcacgctgggcggcggttcgctcttgagctggccgaggaggtcagcgaggaactcatc
atcgatgtcaccgcccaggcctaccagatcaacgccggtacgcgggcggagtgggacgtc
cgccgtaccggcaccgccgctctcggcggcgccttcggcgcggttctcggcaccggtctg
aaagccggcacacgctttgcccgcaacaacctggccccccggatgccgatctcgttcagc
cctccggcggtggacttccccggtgctgggattgcccgctggggcggcaggaccctcgcc
gccggcacgcagaacgccatcgtctcgccggctgccagcgtcctggccaaccgcgtgatg
accggggagtggagcatgcccggcggcgacgcggttctgggaggtttcgccagtggtgct
ggccgcgggggcgccacgatggcggccagcagcggtggtagcgcgttggcgcacctgcac
aacaagctcgccggcctcgaccccagcgcggtgaagggcgccggactggacaccggtccg
agcaacctgccaacaaccgggctcggatcgatctcgcttgcccctccgccggccttcgac
ccggccagcctcgacggtgccggccaggtgggcgtgggcgcggacgccgtcgctggctcc
gtctcaccgtcctcgatggccggtgacccgcagggcggttcgtccaaacatgatgggtct
attgtcgtcgggcaatctgctgcccccaccattcacagcgccctctcgccgttcgccgat
ggctccgtcggggatgactccacggctgactccgctcagcatgcgccgatctccccggac
tcggagcccgcagtcgtgcccgtcgtggcgtcgagtgcccccgcagccgtcggccccacc
gccggcctcctaccaacgacacctgccaccggcggcgccgtcgcgaacccaactgtggcc
gggacaccggcactggcaacggcgcaatcgagccccgccgtcagcccttcgggcagcacc
tcgggtaccagtgcttccgtcgccggtgggagtagccagaccgggagcccccagaccgcg
gccgggccgggcacccagaccggcacgaggactccgccggcgagcggcccgcccgtgcct
accggcaacccgagggcgccgaactcggccggctccgtttcgctcggccccgccaccacc
cccacggcaagcgtccctacgtcgaaactgacgccaaccgttccggcggcgactggtgcc
agcccatcgaccacgccggacccggcgaaccgggttcccacccagcgcgtctccgttgat
ggagcgatgcccgcttcggcgccgtcccacaccggcgctccgaccaccggcactccagac
tcgcccatcggcggcaacgaaacaagcgtcccaaccgaggctcgccgttccacgggccca
accggtggcaacacccacagctggcagggcaagtcgttcaccgttaccggagatccaaac
ggtcgggaggccaagcgaacgctcatcgaggcgtcccggagattggccgaggccgtccgg
acagcagtcaagggaaaggcgatctccaagggcaagatgccgggcatggcgggtgcgctg
atgatgccgaatggcgaggtcacgacccacaccagcatgaccgccgacaagggcacgaag
ccgccgacccagccggcggtacacccagtggtgcaggacgttctcgatcggatcaaggcc
gatctcgaagcgaagcacggcgagggggccgggcacggcaagtgcgccgaggtcgccctg
gtctccgaccagatctatcggctggaggaagagtggcgccaagcgggcgagccgggagca
ctagagcagtacgccctgaatgcgctgagcggcgcgaaagtcgttacgcatcaggtccgc
acaggttgggatgaagcaggtgtcaagcacgacctaggccactatcggctgccgtgtcga
tcatgccgtagcctcttaccgcaatttggcatcgacccgctctcggacccagaacggtca
ccaaaggtctaccagccccccgtgcccggggtggtgggcaatgggcggcccctgagcgac
gaacgcccatacggggagcccgaggggctggtcccgccggagccagctcaccagcaggcg
ttggacgatgccgtgccccgcgacccggagaccggccggccggaagtgcatccggacccg
cggctgcgcagctgggtcggcaaggtcaacgacgggggtccgacagtccccggccgggat
cggaactgcgccgacgtcggcctctccttcctctccacctggttcggtcggcctgaggta
gcggcggccaccatcgaaggggcggatttagagcatgccagcaccgcccggcaggagcag
gcgcttggcagcgctttcagctaccgcggcactggcccatccgggctggacgacattgct
gtcacccttcagggggctggccacggttcggcagcattgattgtcaccacctccacgaaa
gccgatggtcgtgcccacacctggaacgtggtcaaccaccagggactgatcgtatgggtc
gatggtcaggcggggctcgtttctgacgcaggccctttccgcagcgccggtatcggcgac
gtctggtccatcacgctcgacgctgaaggtgaccctcttccgccgggtcagccccagagc
gataccgacgctccggccaccgagccggtcccggttccaccgcactccacggccccggcc
gagggtcagcggccggacgacagtgtcggaggccgcgcggctggcatctctgagcagtcc
tggggcgcggagaatgactacctcggtgccttgtcggatgccgagcgggcgactctcttt
gacgagctcgccgcagcccggtcggaggccacccatatcctcggtgagttgcagagcctc
gccgctggggtcaacgcgcgacttgggttgactggtgcggatgcgctgcggacgttgggc
gaggagcatcgggtcaagggtgcggagtcgctggcccggaagtaccgcacgacgctggcg
acattggggtatgacatcgggtcggctctggccacggtcaacgacgtggtccgcttctcg
ctgcgggggccggagtcagaattgtatggtccggcggttgacaacgttcttgcctcgttg
gaggaaaggggctatcaggttaccaacctgaagaacttctggcgctccggaaaccggttt
ttcggcctgaactgcacgcttgtttccccgggcggtcggacctttgagttgcagtttccg
accgccaccagctacgcgatcgggaaacagacccacgtcccgtacgaggttgtgcgggac
ccggcgcagcctgcggcggaccgggtgcacgcgttcctggacattctcgcgatcaacaaa
tcccagggtgccgctgcgcgcatgccgggtggcatggaggctgtgcgattcggtgaagca
aacgatagcagctttgcaaagtggatcggggcgtcgaagcgagcccgcttgcgtaaagaa
tacctcgactggctcggacagcagccctacgcgttcgccgatgtatgcgttgagcgagga
ttgaccgcgtccgacctgccgggtctggaccgtgacctgataggggagacgcatggagac
gctgacattcggctacttcctcctgcggcgggacccggacggcccgccggtcaacctgat
cgcgaacgccgacaccatgggcccgacgcaggcggtgatctgggatcggtcgaccgacgc
gtggacgttccgtccggacgtggcgggggcgtttctgtgggaggacccggagatgggcga
ggtccaggaggtggatcgggccaccgcggaacgggagacggttcacttcacgacggttcc
gttgccgacggcagcggagttgaccgagatctgtcgcgaggcgttgccgaggtggctccg
gggcgcccggaagtagccgggcccgagctcctgtcggtagagcccgagacgaattacggg
ctacccgagacgcggtccatggggccggggaagctggctccgctggaggatccgcgctat
cagcaggatgttgcgctgagcctgcggacagccgagggctatacatacctggccgacccg
ttcacccacccgtacggtcgcttgatcaacgatggcgggccagccgagcagggccgtggt
aacaactgtctggactgttctctggccgcgttgtccagcttctacggtgacccgcaggtt
gcccagccgcgctggccggacatccgagtcggtggctctttcgagaccgagttgggtgag
gacagtggcctgactcgggccgaagagtggctggggggaatctgggccggtggttcggcc
gggctccccgccgcgcccaccgcacgtgccgccgcggttagtgatcaatatgcccgactg
taccaacgggtcgcgcagtcaggtccaggaagcgcggcgctggtggtggccgactggctc
ggcgctgacgacgtaacgggtgagctcatcctggacgaagagggtggtgtcacccccgac
ggcgcccatgctttcattctcgtctatccgagtggcgtcgaccggccggtgtggtgggac
ccacagcatggggtcgcgatgccggaaccaccacccgcctatgttgcccggacctacgcg
ctctggtcgatgatggtgcccagcggaggtggaacgaatgacggaggacgaggcacgagc
gctgatcactcgtctgctggggacccgaaatccggtccggctgggcgagttcgagttcgg
ctgggtggctcgggaggaactctcggaggaggagcgagcctcgggaaggcacgtgggtca
ggggcgattcatcatcgaccggacgggcgtggtgacagcccactcgagcctgccgcccca
gctgattcttcagcagtacgtgggagcccgccgccaaggccgcttcacgggacgacaggt
ctggccgaggggggaccagccgggctgaacccaaccgacacggagtcggccgccacctcg
gttgtcccgccgctcaccgccgctgacgtggccgagctggcgacggtcacgcaccagctg
cggacggcgaacaccttttcccgtgtggctgtccgacgggaactcactgccactgtggat
cggctggggctgcgggacggcatgctcggcgcggagcagcggatggccaccctgcccgcc
gaggtgcgggccgccttggccgaggtgatcaaccaaggttcggcccacacgagcgagcgt
tcccggctacgccccgatcgccgtacctccgaggcgaaggagcgccctgtcggcctgccg
cggatgcgcacgtacgtcggcacgcaccttaccgtgaactcgctcctcctcacgctggcg
acgacgttcaccctcaacgccggcggtcgacccgagctggccctgatgctgggcgccggt
gcgttcgtgggcgccgtcaccaccggcccaacgaagtggctggccaagcgagcggggctg
gcggccgaggatcgtcgggcccggtacgacgcccgccaggacgcccggaccgcggcggag
gaggacgtggccaccgcagcggtgctcgtcgcccacaccgacgacgtgacctcgacagtt
cagaagctgggtgcggcgacgaccgggctcgacggacaggtgtcggccgttcaggagcag
ctacgtcgggacgagcgtaggcatcgtgtgatgggccctcctcgccggttcccgtcggcg
ggcgaggacgcaccggcggtgtccgacgacagccccggaaccggtacgagttcggctggc
gccccgggtggttcgaccgccgtcgggctgacctcgcgtgagcgggagcgccttgccgag
ctgcgtagcctcgtcgcccgtcacgatggggcgcggccatgggctcggtttggtgtcggc
cgggagatccgggcactgctgaacagcctcgggctgcggcagggaacgcccggcgtggac
caccgtcgggacctggtgccgccagacgtacggccgctcgttgaacggttcggcggctcg
cgtacggctgtggtgcgggcccgggcccgagccgtcattgaccgctacccggctgacgat
cagcgtccgggtacggtcgcgccatggtggatgtcggcggtggagaacgcgccgaacctg
ctgacagccaccaccgtggcgggggtcggtgacctcctcggtcagctgagactcggctgg
ttcgggatcgcgggcgcgctcgccgcagcggcgaccggtgtggcggttgacccggtggtc
gcccgacgggaggccgtcgccaaggacgcccgggatacctgggatgcggacaaccccgcg
gtgcctgcggaggcgctgctctcccaggcggccgaagcggtcgccgatccgatcagcgcg
gtggccgaccgcgccgcgaccgccgtgcgccgcacggccgacctggagcagcgcctcgcc
gatctggagcgccgggtcaccgactcgcagcgccgcaacggcctgattgactccttccgt
cgcctgctcttcggcgacccggcctgggccggactgcccccgtcgaaggacgccactccc
atatcgaaggacgccactccggcgtcgcgggcgtccgccgacccggaagcgtccaccgat
ccggccgccgagccgtcggtcggctcgcgtgacccggcgtcgctgcaacagcttgctgag
ctcgccgtacggcatgggtccgtcggcccgttggcgcgcccgtcagtggcccggcaactg
cggttcctcatcgaccggctcggtctgcgcgaggggacaccgggtgcggaccagcggcgt
gcgcaggtgccggacgagctgcggccggtggtggagcggcacgggcagctgggcgtgacc
agccgggtgatcacgcgtttcagtcgcccgccggctctggcgacggacagcaccgaacgg
ccgagcaatatgcggagcctccgggttttcgcggtcgagcagaccctcggaccactggtg
caggccggcacgtgggtcggggtggcccaggtctcccagatcgccgcgggggccgggccg
agcaagatcctggctggggggctcctcggtccgctccgtgacctgctgctcaatcgtgcc
gagacccgggtcaaggacgcacgacgggcctgggacctggccaaccccaatccggcgatg
gagccgaagacgagggcggcggggctcgccggcccgtcggcgacagccgtgaccagcgcc
gttgggcagctcgatgtggcctcccggcgtctcgacgacattacgtcgacgctggaccgg
ctggcgcagggacatgctgccggcccatcggacccggctgccaccccgggcatcggggag
ccgctggacgtcgccggtccggcctcgctgaacagggcggatgcctgggagttgcagacg
gccgcacaccaggtgcggacggccgacgcgctctcgttgaggccggccctgcgcgaactg
cacgcggtgatcgaccggctgggtctgcgggcgggcatgctcggggcgccggatcggatc
gcgcagctgcccggagtggcccggcgggtggtcgccgagttcggcggtgaccgtgccggc
cgggcgcgacagctacgcacgctccgggcgcagcggcggaccgccgagaacactcgcccg
ccgggtatccccggccttcggacctatcttgtctcgagcgggctgaccaccgccgcgacc
gccggagcggccaccgcggtcgccatcgcggtggccagcccactgacgccggtgatcccg
atcgccgcagccgtcgccgcgccggtgatcggcgtctccaagtggtacgccaggcggcgg
ggcctcgccgctgacgacgtgcgcagccggtttgacgcacgtgtcgacgcccggggcgcc
gccgaccaggtggaccaggtcgttgaccgggtgaacgagccggtcgccgagctggaacgg
gcggccaaccggctcgagggccagctcggcgccgccgagtcggccaccgaccggttggcc
gagaggctggcggagacccatcgccgtgtcggcctgctctcccgtctcttcgacatcgtc
ggctgggggccgacagccccgacggggtccaacccggaagccggtgcggtccgggagagc
cgcggcagcccagaagactcacccgaatccgggcggatcacggcggcggccgtaccgaac
tcgggcttccacggtctggggcggcccgtcgccgacccggtcgcggtgctggccaccgcc
cacgccgcgttgccgcaggtggcttcctacgccggggtggacgacatcggcccaaccggg
ccgaatcgcttcgagatctacgcggccggacggttttcgttccgggtatggctgaccacc
ggtccactgaccgacggtgtggtggcccagacgacgcgcaactcggacggatcgttcacg
gtgaccgtctcggatcgggcggtggacggagtggtcgcccgcgcgctcacgcacgaaatc
gcagagctggcggccctgcacgattcccggcagatcctgattggaccgttggacccgggg
accgatgacgggctgatcaacccggcggggcttaccgcgcatgaccaagggcggatggcc
gagattcgcctactcgccgccgagtacgagttcgccggcccgcccacccgactcgctctc
cgcgtcgagatcgatgccctcgccaaccatcttggcctgcggctgggggatccggccgca
cctggacgtgcggcaatcatcccccgggacgtgcacgcgcaactgatgcgtctgagcacg
ccatcggtgacgcaggagtcggtcgccgaggtcctggatggcagtccagcgacagaagtc
gaacagcgtcggtgggtcgactaccgcaaccaactcgtcccggactcccaggtgccgtca
accaccgaactccaggcccggctgcacgagctggcgatccagggcgagcgggagcaggtc
agcctcccccgaatgtcggcccacgccgggcagatcctccacctgccgccggctcagctg
ggcctgatccgggacgtgcacccgacactcgccgaccggatcgccgccgagggcgtctac
gtcgacctggcgggccggttcgacctgcgcccgtacgcgctcaccgacgccccggagttc
tcgctggcggagtcgcggtccgccttcgacctgggcgcggaggtggggcggcagtcgctg
ctggccgaggaccgggcccgaggttatgtcgtcatccgcgccgcctttggtgcgcgctcc
gccgccatggccatgctgcacacgcacgacctccactacctgaccaacgctagaaagctg
gccctggtgccgggtgtcctcgcccgggcgctgtacgcgctggtgcccggcgcaccgcca
ctggacctggaggtgaccccgacagcaaccgccgccgaggtcaccgtgatcgccgaccgg
gtcacactgccggcgggggagtcgggcgagcccgcacccgagtacggccggccacgcgac
ctgtggaccgggcaaccggccccactcttcgacgggccgcccaagcgggagcaggtgcag
cagggaaagcttggtgactgcgggatgctggccagcatggccgccgtcgccggccaccgt
ccggaggcgatcgcgcagctcttccagcccaacccggacggcaccgtggacgtcctgctg
cacgagagcaccctgcttggcgactcaatcgggccgaccggccggcggctgcggatcacc
gtgcaccccgacgtgccgatatgggactccgtgagcggtgagtcggcgtacgccgaccag
agcgtgatcggcagctcgtgggcgtcgctgctggagaaggcgctcgcggcggtggaccgg
acctggagcagcgaccgtcaccagcagtggcagctcacctgggccgcatgggagagcccg
aacgacccgctcgtggccgcaccgaccggatacgcccggttggatgtcggcagccatcgg
cagatgcaggccgaactcctcacccagctcaccggcctgccgagccgcgctgcctccttc
gaccagacccctgggcgggaaaccgccagcgaagcccggctggccgcactgctggccgcc
ggcagcccggtgatcaccgctacccgaggcgaggaccagtatccggcggcgatccgcaat
cagcttccgcacgggctcgtcgccggacacgcctacgaggtggtggcggtcggcaacggc
caggtgcagttgcataatccctggaacacgagacatccgacgccgatgacggtgcgggag
ttcctcgacctgatgaatgagagcttcgcctacctggagccgccgccgaccccaccggtc
cagtcatccgacccgcacacccttgggcggacctggctggaagagctggggtactccatc
gcctactacgccctgctcgccgccgacggtacggtgagtggcctggtggtgtcggagtcg
tccaggcggggacaacgcacccggcactggatggctgccggagcgccgtccgctcccggg
agcgcgctgcccgtcgaccggaccgaggccgagcggatcgcgcgggaggcgcttggcttc
acgctgcccgacgagccggcactgcacgacatgctggagggatga

DBGET integrated database retrieval system