KEGG   Salinispora tropica: Strop_1166Help
Entry
Strop_1166        CDS       T00504                                 

Definition
(GenBank) Alcohol dehydrogenase, zinc-binding domain protein
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
stp  Salinispora tropica
Pathway
stp00010  Glycolysis / Gluconeogenesis
stp00071  Fatty acid degradation
stp00350  Tyrosine metabolism
stp00625  Chloroalkane and chloroalkene degradation
stp00626  Naphthalene degradation
stp01100  Metabolic pathways
stp01110  Biosynthesis of secondary metabolites
stp01120  Microbial metabolism in diverse environments
stp01130  Biosynthesis of antibiotics
stp01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:stp00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Strop_1166
  Lipid metabolism
   00071 Fatty acid degradation
    Strop_1166
  Amino acid metabolism
   00350 Tyrosine metabolism
    Strop_1166
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Strop_1166
   00626 Naphthalene degradation
    Strop_1166
Enzymes [BR:stp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Strop_1166
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N_2 ADH_zinc_N ADH_N AlaDh_PNT_C ADH_N_2
Motif
Other DBs
NCBI-ProteinID: ABP53636
UniProt: A4X436
Position
1306371..1307372
Genome map
AA seq 333 aa AA seqDB search
MQAYVQTKYGDPSVMRLMDVPTPTPEHGEVLIRVRAAGLNPVDYHIRDGKMRMIARMKLP
KVAGSELAGVVEAVGPGVTGLAVGDRVFTRVDVMKLGAFAPHAVVAADLVAPMPQSLDFT
EAAGLPLAGLTALQALRDELTIEKGQRIFISGGAGGVGTLAIQLAAWMGAQVATTASPGG
ENLVRSLGAETVINYQTTSFADVLRDYDAVLDLRGGQDLADSFAIVRPGAKVVSVAGVPE
RNSAKDLGAGPLVGALFNLLSGKVRRQAKAHGVTYRYLFMHPSGADLRILADLVDGGNLK
VVTDQVFPFEEIADAFARLERGHAKGKIIVAMP
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
gtgcaggcatacgtacagaccaagtacggcgacccgagcgtcatgcgactcatggacgtg
cccacgcccacgcccgagcacggtgaggtgctgattcgggtacgggcagcaggcctcaat
ccggtggactaccacatccgggacggcaagatgcggatgatcgcccggatgaaactgccg
aaggtggccggcagcgagctggcgggcgtggtggaagccgtcgggcccggcgtcaccggc
ctcgccgtcggggaccgggtgttcacccgcgtcgacgtcatgaagctgggcgccttcgcc
ccccatgcggttgtcgcggcggacctcgtcgccccgatgccgcagtcgctggacttcacc
gaggccgccgggcttcccctggccggcctcaccgcgctacaggccctgcgggacgagctc
accatcgaaaagggccaacggatcttcatctccggcggtgcgggtggcgtgggcacactc
gccatccaactcgcggcatggatgggcgcccaggtcgccacgaccgcctcgcccgggggt
gagaatctggtgcggtcactcggtgctgagacggtcatcaactaccagacgaccagcttc
gcagacgttttgcgggactacgacgcggttctcgacctccggggtggtcaggatctggcg
gacagtttcgccattgtccgtcccggagccaaggtggtgtccgtcgcgggagtgcccgaa
cggaactcagccaaggacctgggcgccggtccactggtcggtgccctgttcaacctgctc
agtggcaaggtccggcggcaggccaaggcgcacggggtcacctaccggtatctgttcatg
caccctagcggtgccgatctgcgaattctggccgacctcgtcgacggtgggaacctgaag
gtggtgacggaccaggtcttccccttcgaggagatcgcggacgccttcgcccgcctcgag
cgtggccacgccaagggaaagatcatcgttgcgatgccctga

DBGET integrated database retrieval system