KEGG   Salinispora tropica: Strop_1487
Entry
Strop_1487        CDS       T00504                                 
Name
(GenBank) hypothetical protein
Organism
stp  Salinispora tropica
SSDB
Motif
Pfam: AA_permease_2
Other DBs
NCBI-ProteinID: ABP53953
UniProt: A4X503
Position
1694384..1696474
AA seq 696 aa
MAVVARPASLVKRLLVGRPFRSDRLQHTLLPKRIALPVFASDALSSVAYAPDEILLMLSF
AGASAFVFSPWIALAVVVVMLAVVASYRQNVYAYPSGGGDYEVATVNLGRRAGVGVASAL
LVDYVLTVAVSVSSGVANLGAVIPFVATHKVAVAVGAVVLLAAVNLRGIKESGTTFAIPT
YGFMIVIVGMILTGLVRVVLLGHDLRAPSADLVIAAEWSDTTGWAMAFLLLRSFSSGCAA
LTGVETISNGVPAFRAPKSRNAATTLLMLGVVAVTMLVGIVWLARLTGLQFVEDPARQIV
AGPDGYVQKTVTAQLGETIFGSGSLLLFVVVGVTALILFLAANTAFTGFPVLGSILAQDR
YLPRQLHTRGDRLAFSNGILFLAGFAIVLIVGFQAEVTRLIQLYIVGVFVSFTLSQAGMI
RHWNRYLRVERDPQVRRQMIRSRAINSFGMAMTASVLVIVVVTKFLLGAWIAIAAMIMIY
LVMLGIRRHYDRVFAELTPDEGRPVKPARNHAVVLVSKVHQPTLRAIAYAQVTRPDSLTA
VTVNVDDKDTRRLQAEWERRDVPVPLTVIDSPYREITRPILNYVAGVRRSSPRDVVTVFI
PEYVVGRWWENLLHNQSALRLKGRLLFEPGVMVTSVPWQLASTEGKDLDRLDETLSRGPA
RGPRATPSGPEPAPAPPTVPAPPPRSGPDPSDGGAR
NT seq 2091 nt   +upstreamnt  +downstreamnt
ttggcggttgtggcccgccccgcctcgctggtgaagcgactgctcgtcggtcgaccgttc
cggtccgaccgactccagcacaccctgctgcccaagcgcatcgccctgcccgttttcgcc
tctgacgcgctctccagcgtggcgtacgcccccgacgagatcctgctgatgctctcgttc
gccggggcctcggcgttcgtcttctcgccgtggatcgctctggcggtggtcgtggtgatg
ctcgctgtggtggcgagctaccggcagaacgtgtacgcctacccgtccggcggcggcgac
tacgaggtggccacggtcaacctggggcgccgtgccggcgtcggcgtggccagcgccctg
ctggtcgactacgtgctgaccgtcgccgtgtcggtctcctccggggtggcgaacctgggc
gcggtgatccccttcgtggccacccacaaggtggcggtggccgtcggcgcggtggtgctg
ctcgccgccgtcaacctgcggggaatcaaggagtccggcaccaccttcgccatccccacc
tacggcttcatgatcgtcatcgtcggcatgatcctcaccgggctggtccgggtggtgctg
ctcggccatgacctgcgcgctcccagcgcggatctggtcatcgccgccgagtggagcgac
acgaccgggtgggcgatggcgttcctgctgctccggagcttctcctccggctgcgccgcg
ctcaccggcgtcgagacgatctccaacggggtgcccgcctttcgggcgccgaagagccgc
aacgcggcgacgaccctgctcatgctcggcgtggtggcggtgaccatgctggtcggcatc
gtctggctggcccggctgaccggcttgcagttcgtggaggacccggcccgacagatcgtc
gccggccccgacgggtacgtgcagaagaccgtcaccgcgcagctcggcgaaaccatcttc
ggctccgggtcgctgctgctgttcgtggtcgtcggcgtcaccgccctgattctcttcctg
gccgcgaacaccgccttcaccggtttcccggtgctcgggtcgatcctcgcccaggaccgc
tacctgccccgacagctacacacccggggcgaccggctcgccttctccaacggcatcctc
ttcctggccggcttcgcgatcgtgctgatcgtcggcttccaggccgaggtgaccaggctg
atccagctctacatcgtcggcgtctttgtctcgttcacgctgtcccaggccggcatgatc
cggcactggaaccgctacctgcgggtcgaacgcgacccacaggtacgtcggcagatgatc
cgctcccgggcgatcaacagtttcggcatggcgatgaccgccagcgtgctggtgatcgtg
gtcgtcacgaagttcctgctcggcgcgtggatcgccatcgctgcgatgatcatgatctat
ctggtgatgctggggatccgtcggcactacgaccgggtctttgccgaactcacccccgac
gaggggcggccggtgaagccggcacgcaaccacgcggtcgtactggtcagcaaggtgcac
cagccgaccctgcgggcgatcgcctacgcgcaggtcacccggccggacagcctgaccgcg
gtgacggtgaacgtcgacgacaaggacacccgccggttgcaggccgagtgggaacggcgg
gacgtgccggtcccgctgaccgtgatcgactcgccgtaccgggagatcactcgcccgatc
ctcaactacgtggctggcgtccgtcggtcctcgccccgtgacgtggtcaccgtcttcatc
cccgagtacgtggtcggtcgctggtgggagaacctcttgcacaaccagagcgcactgcgg
ctcaaggggcggctgctcttcgaaccgggagtgatggtgaccagcgtgccgtggcagctc
gcctcaaccgagggcaaagatcttgaccggctggacgagacgctcagccgaggaccggcc
cgcggtccccgggcgacgcccagcggcccggagccggcacccgccccgccaacggtcccc
gctccgccgcccaggagcggcccggacccgtccgacgggggtgcccggtga

DBGET integrated database retrieval system