KEGG   Salinispora tropica: Strop_1637Help
Entry
Strop_1637        CDS       T00504                                 

Definition
(GenBank) UDP-galactopyranose mutase
  KO
K01854  UDP-galactopyranose mutase [EC:5.4.99.9]
Organism
stp  Salinispora tropica
Pathway
stp00052  Galactose metabolism
stp00520  Amino sugar and nucleotide sugar metabolism
stp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:stp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    Strop_1637
   00520 Amino sugar and nucleotide sugar metabolism
    Strop_1637
Enzymes [BR:stp01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.9  UDP-galactopyranose mutase
     Strop_1637
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GLF NAD_binding_8 Amino_oxidase FAD_oxidored Thi4 Lycopene_cycl Pyr_redox_2 FAD_binding_2 NAD_binding_9 DAO Pyr_redox HI0933_like 3HCDH_N GMC_oxred_N FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: ABP54102
UniProt: A4X5F2
Position
1863297..1864448
Genome map
AA seq 383 aa AA seqDB search
MNVDLVVVGAGLCGLTVAERCANRLGMRVLVVEARRHIGGNAYSELEPETGIEVHRYGAH
LFHTSNESVWAYANRFTRFTDYVHRVYIRRGDEIFPLPINLATINQFTRSAMSPSEAAAW
VRDRAAQYRDGDVGNLERKAISLIGRDLYEAFVRGYTAKQWEADPMDLPAAVITRLPVRY
TYDNRYFSDTHEGLPVDGYTRWFERMIDSDRVEILLGNDFLDRQSAVNKHNTVGRVEVVY
TGPLDRYFDRAVGGLTWRTLDFAWEIVPTGDYQGTAVINYADRSVPFLRTIEFRHFHPER
DYPRDRSVIAREYSRLARPEDEPYYPVNSTMDRRILRRYRDLARQETGVHFGGRLGTYRY
LDMHMAIASALRVVDRLAARRTV
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtggacctggtggtcgtcggtgccgggttgtgtggcctgaccgtggccgaacgg
tgcgccaaccgcctggggatgcgggtgctggtggtcgaggcgcggcgtcacatcgggggc
aacgcctacagcgaactggaacccgagaccggaatcgaggtgcaccgctacggcgctcac
ctgttccatacatcgaacgaatccgtgtgggcctacgccaaccggttcacccgcttcact
gactatgtccaccgtgtctacatccggcgtggcgacgagatctttccgctgcccatcaac
ctggccacgatcaaccagttcacccgctcggccatgtccccgagcgaggcggcggcctgg
gtgcgagaccgcgctgcgcagtatcgcgacggtgacgtcggcaacctggagcggaaggcg
atctcgttgatcgggcgggacctctacgaggcgtttgtccgtggatacacggccaaacag
tgggaagcggacccgatggaccttcctgcggcggtcatcacccgacttcccgtgcgatac
acctatgacaaccggtacttcagcgacacccacgagggactgcccgtcgacgggtacacc
cgctggttcgagcggatgatcgacagcgaccgggtcgagatcctgctgggcaacgacttc
cttgaccgccaatcagcggtcaacaagcacaacactgtcggccgcgtcgaggtggtttac
accggtccgctcgaccgctacttcgaccgcgcggtgggcgggctgacctggcggaccctg
gacttcgcgtgggaaatcgttcccaccggcgactaccagggcacagccgtgatcaactac
gccgaccgtagcgtcccctttctgcggaccatcgaattccggcacttccatccggagcgc
gactacccccgcgaccgcagtgtcatcgcccgggagtactcccgtctcgcccgccccgag
gacgagccgtactatccggtcaactccacgatggaccggcgcatcctgcgtaggtaccgg
gacctggcgcgacaggagactggagtgcacttcggcggccggctcgggacgtatcggtat
ctcgacatgcacatggcgatcgcctcagcgcttagagtggtcgaccggttggccgcccga
cggacggtgtga

DBGET integrated database retrieval system