KEGG   Salinispora tropica: Strop_1807Help
Entry
Strop_1807        CDS       T00504                                 

Definition
(GenBank) 3-hydroxybutyrate dehydrogenase
  KO
K00019  3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
stp  Salinispora tropica
Pathway
stp00072  Synthesis and degradation of ketone bodies
stp00650  Butanoate metabolism
stp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:stp00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    Strop_1807
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    Strop_1807
Enzymes [BR:stp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     Strop_1807
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short Epimerase NAD_binding_10 TrkA_N KR NAD_binding_7 Methyltransf_11 Shikimate_DH AdoHcyase_NAD 2-Hacid_dh_C THF_DHG_CYH_C RmlD_sub_bind Methyltransf_25
Motif
Other DBs
NCBI-ProteinID: ABP54270
UniProt: A4X5X0
Position
complement(2067527..2068312)
Genome map
AA seq 261 aa AA seqDB search
MTADPRRTAPHVVQVDLTGRTALVTGGGSGIGRTCARRLGAAGATVVVVDRDIAAARTVA
ADVGGRAVGADLADPETVNRLDTKVDIVVNNAGLQHVAPIPEFAVERFEYLHRVMVEAPF
LVIRRALPHMYAAGWGRIVNISSVHGLRASPYKAAYVSAKHALEGLSKVVALEGAAHGVT
ANCVNPAYVRTPLVQSQIADQAASHGIPESEVVEKIMLGRAAIKRLLEPEEVAELVAYLC
SPPAAFITGASIALDGGWTAN
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgacggcagatccgaggaggacggccccccacgtcgtacaggtcgatctcaccggtcga
accgccctggtgaccggaggcggcagcggcatcgggcggacgtgtgcgcgacgactcggc
gcggccggcgccaccgtggtggtggtggaccgggacatcgctgccgcccggacggtcgcc
gccgacgtgggcggccgggccgtcggcgccgacctggcggacccggagacggtcaaccgc
ctcgacaccaaggtggacatcgtggtcaacaacgccggactccagcacgtcgccccgatc
ccggagttcgccgtggaacgcttcgaatacctgcaccgggtgatggtcgaagccccgttc
ctggtcatccgccgggccctgccgcacatgtacgccgcaggctggggacgcatcgtcaac
atctcctcggtgcacgggctgcgcgcctcgccgtacaaggcggcgtacgtctcggcgaaa
cacgccttggagggtctgtccaaggtagtcgcgttggagggcgccgcgcacggggtgacg
gccaactgcgtcaacccggcgtacgtgcgcaccccgctggtgcagagccagatcgccgac
caggccgccagccacggcatcccggagtccgaggtcgtcgagaagatcatgctgggccgt
gcggccatcaaacggctgctcgaaccggaggaggtggccgagctggtggcgtacctgtgc
tcaccaccggcggcgttcatcaccggtgcgtccatcgctctcgacggggggtggacggcg
aactag

DBGET integrated database retrieval system