KEGG   Salinispora tropica: Strop_2415Help
Entry
Strop_2415        CDS       T00504                                 

Definition
(GenBank) hypothetical protein
Organism
stp  Salinispora tropica
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF421 DUF4902
Motif
Other DBs
NCBI-ProteinID: ABP54862
UniProt: A4X7L2
Position
2712267..2712767
Genome map
AA seq 166 aa AA seqDB search
MVDWRAVFTPDTPLMEIIVRGSVMYLTLFFLLRVLLKRESGTTGMTDLLVIVLIADAAQN
GMASGYTSLADGVLLVAVIIGWAYLLDAVAYRWQPAARLIRPKPLALVRDGRMLHRNMRR
ELVTEDELYGQLREQGIDSLAEVREMRMESDGQFSVITRRPGKQRP
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
gtggtcgactggcgggcggtcttcacgccggacactccgctgatggagatcatcgtccgg
ggcagcgtgatgtacctgacgctgttcttcctgctgcgggtcctgctgaaacgggaaagc
ggcaccaccggaatgaccgacctgctggtcatcgtgctgatcgccgacgccgcgcagaac
ggcatggcaagcggctacacctcgctcgccgacggggtgctgctggtcgcggtgatcatc
ggttgggcatacctgctcgacgcggtcgcctaccgctggcaacccgccgcccgactgatc
cgaccgaaacccctggccctggtccgggacggacggatgctgcaccgcaacatgcgtcgg
gaactggtcaccgaagacgagctgtacgggcagctgcgggagcagggcatcgacagcctg
gctgaggtccgggagatgcggatggagtccgacggccagttcagtgtgatcacccgtcgc
cccggcaagcaacgaccctga

DBGET integrated database retrieval system