KEGG   Salinispora tropica: Strop_2441Help
Entry
Strop_2441        CDS       T00504                                 

Definition
(GenBank) major facilitator superfamily MFS_1
Organism
stp  Salinispora tropica
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 Sugar_tr
Motif
Other DBs
NCBI-ProteinID: ABP54888
UniProt: A4X7N8
Position
2743318..2744877
Genome map
AA seq 519 aa AA seqDB search
MPTRQPGPARRSHGAMSNASATAAPAPVDLPVAIGKVPHRWLILAILCLTQLVVVLDNTV
LTVAVPVLTVELDAGTADVQWMINAYALVLSGLLLSAGSAVDRYGRRRMLLVGLVLFGVG
SLAAGLARTSEQLIAARAGMGVGGALLVTATLALAMQVFDSAERSRAIGIWAATSALGFA
AGPPIGGIVLAHLPWGAIFLMNIPIVLVCLLAGRALIPESRNPASGRLDLIGVALSTVGL
TAIVWAIISGPELGWASTKVLGAGAAGVLLLGLFVRWEQRVAHPMLDMHFFRNRRFVGAV
CGVVLITFGATGALFLLTQHLQFVRGYPAWEAGLRMVPFALSIVVLNVAGVATLAIRRLG
LPAAIATGMTLLAGGLALVTHVPSEGYGTLLAGLLIMGTGCALANPAIVEAVMSAIPTDK
AGAGAGVDGTMTEVGSSLGIAVLGAVLNARFAALLPAALAGAGSFPAALAAAGPDREAVT
AAFADALRTGQTVGAVAVLVGGLVAAALLHRADRISARS
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
gtgccgactcggcaacctggccccgcacgacgaagccacggcgcgatgagcaacgcttca
gcgaccgccgcgccggcgccagtagacctccccgtcgcgatcggcaaggtgccgcaccgc
tggctgattctcgcgatcctctgcctgacccaactcgtcgtggtgctggacaacaccgtg
ttgacggtggcggttccggtactcaccgtagagctcgacgccggcaccgccgacgttcaa
tggatgatcaacgcgtacgcgttggtgctgtccgggctgctgctcagcgctggcagcgcg
gtagaccggtacgggcggcggcggatgttgctggtcgggctggtgctgttcggcgtgggc
tcactggcggccggcctcgcccgtacctccgagcagttgatcgccgcccgggccggcatg
ggcgtggggggcgccctgctggtgaccgccaccctcgccctcgccatgcaggtcttcgac
tccgccgagcgatcccgggcaatcggcatctgggcggcgaccagcgcgctgggcttcgcc
gccgggccaccgatcggtgggatcgtcctcgcccacctgccctggggcgcgatcttcctg
atgaacatcccgatcgtgctggtctgtctgctcgccggccgggcgctgatcccggaatca
cgcaacccggccagcggccgcctcgacctgatcggagtggccctctccaccgtcggcctg
accgcgatcgtctgggcgatcatctccggtccggagctcggctgggcctcgacgaaggtc
ctcggcgccggcgccgccggcgtgctgctgctggggctcttcgtccgctgggagcagcgg
gtcgcccacccgatgctggacatgcacttcttccggaaccgccgcttcgtcggcgcggtc
tgcggcgtggtgctgatcacttttggcgccaccggcgcgctcttccttctcacccagcac
ctgcagttcgtccgcggctaccccgcctgggaggccgggctacggatggtgccgttcgcg
ctctccatcgtggtgctcaacgttgccggcgtcgccacgctggcgatccgccggctcggg
ctgcccgccgccatcgccaccggaatgaccctgctcgccggcgggctggcgctggttacg
cacgtcccctccgagggctacggcacgctactggccgggctgctcatcatgggtacgggc
tgcgcgctggcgaacccggccatcgttgaggcggtgatgagcgcgatccccacggacaag
gctggcgccggggccggcgttgacggcaccatgaccgaggttggcagcagtctcggcatc
gccgtgctgggtgcggtgctcaacgcccgcttcgccgcgctgctgcccgccgcactggcc
ggcgccggctcgttccccgcggccctggccgcggcgggcccggaccgggaggcggtcacc
gccgccttcgccgacgcgttgcgcaccggtcagacggtgggggcggtggccgtcctggtc
ggcggcctcgtcgccgccgcgctgttgcaccgcgccgaccgcatctccgcccggagttga

DBGET integrated database retrieval system