KEGG   Salinispora tropica: Strop_3225Help
Entry
Strop_3225        CDS       T00504                                 

Definition
(GenBank) leucyl-tRNA synthetase
  KO
K01869  leucyl-tRNA synthetase [EC:6.1.1.4]
Organism
stp  Salinispora tropica
Pathway
stp00970  Aminoacyl-tRNA biosynthesis
Module
stp_M00360  Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:stp00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Strop_3225
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:stp01007]
    Strop_3225
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:stp03016]
    Strop_3225
   03029 Mitochondrial biogenesis [BR:stp03029]
    Strop_3225
Enzymes [BR:stp01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.4  leucine---tRNA ligase
     Strop_3225
Amino acid related enzymes [BR:stp01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   Strop_3225
Transfer RNA biogenesis [BR:stp03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    Strop_3225
 Prokaryotic Type
    Strop_3225
Mitochondrial biogenesis [BR:stp03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Strop_3225
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1_2 tRNA-synt_1 tRNA-synt_1g Anticodon_1 tRNA-synt_1e
Motif
Other DBs
NCBI-ProteinID: ABP55659
UniProt: A4X9S8
Position
complement(3694890..3697754)
Genome map
AA seq 954 aa AA seqDB search
MTEAAAPASDIPPFRYTADLADEIERRWQDTWEREGTFHAPNPTGPLADPEHPRAGAEKL
YVLDMFPYPSGAGLHVGHPLGYIGTDCFARYQRMAGRNVLHAMGFDAFGLPAEQYAVQTG
THPRTTTEANIARYKAQLRRLGLAHDERRSVATIDADFYRWTQWVFLQIYNAWYDSSAKR
ARPIAELVAEFSGGSRRTPDGRPWGELTDAERRAVVDQHRLAYVSQAPVNWCPGLGTVLA
NEEVTADGRSERGNFPVFKRNLKQWMMRITAYGDRLLDDLEKLDWPEPIKLMQRNWIGRS
TGAHIEFPTSAPDSDAEGEPRISVFTTRPDTIFGATYLVLAPEHDLVDTLVPTAWPAGVP
QAWTGGQASPREAVAGYRKVAAAKTDLERQAETKEKTGVFIGSYATNPVTGAQIPIFIAD
YVLAGYGTGAIMAVPGQDERDWAFAEVFDLPIVRTVQPAEGFAGKAYTGDGLAINSATPE
RGLDLNGLGVAEAKARTIAWLEAGGHGSGAVTYRLRDWLFSRQRYWGEPFPIVYDETGAA
IALPEELLPVELPEVDDFAPRTFDPSDAESNPETPLSRRRDWVEVELDLGDGPKRYTRET
NVMPQWAGSCWYELRYLDPTNGDRFVDPEAERYWMGPRGEGDCGGTDLYVGGAEHAVLHL
LYARFWHKVLYDLGHVSSFEPFRKLFNQGYIQAYAYTDARGAYVPAEEVVERSGTYYLGD
VQVNREYGKMGKSLRNVVTPDEMCAAYGADTFRVYEMSMGPLEVSRPWETRAVVGSFRFL
QRVWRAIVDERSGASRVVDVPADEATRRLLHRIVDGVRGDMEAMRFNTTIAKLIELTNAL
TRLPETPREVAEPLVLMLAPFAPHVAEELWRRMGHETSLTYADFPVADPALLVAESVTYP
VQVNGKVRGRIEVPADAGQETVRAAALEAVAASLAGKEPRKVIVVPGRMVSVVA
NT seq 2865 nt NT seq  +upstreamnt  +downstreamnt
atgactgaggcagccgcaccggccagcgacattccccccttccgctacaccgcggacctg
gccgacgagatcgagcgccgttggcaggacacctgggaacgcgagggcaccttccacgct
cccaacccgaccggcccgctggccgaccccgagcatccgcgggcgggagcggagaagctg
tacgtactggacatgttcccgtacccgtcgggcgctggcctgcacgtcggccacccgctg
ggctacatcggcaccgactgcttcgcccgctatcagcggatggccgggcggaacgtgctg
cacgcgatgggcttcgacgccttcgggctccccgctgagcagtacgcggtgcagaccggc
acccacccgcgtaccaccaccgaggcgaacatcgcccggtacaaggcacagctgcgccgg
ctggggctggcccacgacgaacgccgctcggtggccaccatcgacgccgacttctaccgc
tggacccagtgggtcttcctgcagatctacaacgcctggtatgacagctcggcgaagcgg
gcccgcccgatcgccgaactggtcgccgagttctccggtggttcccggcgcaccccggac
gggcgaccgtggggcgagctgaccgacgccgagcggcgggccgttgttgaccagcaccgg
ctggcgtacgtctcgcaggcaccggtcaactggtgcccgggactgggcacggtgctggcc
aacgaggaggtcaccgccgacggccgctccgagcgggggaacttcccggtcttcaagcgg
aacctgaagcagtggatgatgcggatcaccgcgtacggtgaccggctgctggacgacctg
gagaagctggactggcccgagccgatcaagctgatgcagcggaactggatcggccgctcc
accggcgcgcacatcgagttccccacctcggccccggattcggatgcggagggcgagccg
cggatcagcgtcttcaccacccggccggacacgatcttcggcgccacctacctggtgctg
gcgcccgagcatgacctggtcgacaccctggtaccgacggcctggccggcgggggttccc
caggcctggaccggcgggcaggccagtccacgggaggcggtggcgggctaccgcaaggtg
gccgcggcgaagaccgacctcgagcggcaggccgagacgaaggagaagaccggcgtcttc
atcgggtcgtacgccaccaacccggtcaccggggcccagattccgatcttcatcgccgac
tacgtgctggctggctacgggaccggcgcgatcatggcggtgcctggtcaggacgagcgg
gactgggccttcgccgaggtgttcgacctgcccatcgtccgcaccgtccagccggcggag
ggctttgccggtaaggcgtacaccggtgacggcctggccatcaacagcgccacgcccgaa
cgcggcctggacctgaacggcctgggcgtcgccgaggccaaggcccggaccatcgcctgg
ctggaggcgggcggccacggctcgggcgcggtgacctaccggctgcgggactggctgttc
agccggcagcggtactggggtgagccgttcccgatcgtgtacgacgagaccggcgccgcc
atcgccctgccggaggaactgctgccggtcgagctgcccgaggtggatgacttcgcgccc
cgcaccttcgatccctcggacgcggagtcgaacccggagaccccgctgtcgcgacggcgg
gactgggtcgaggtggagctggacctgggcgacggtccgaagcgctacacccgggagacc
aacgtgatgccgcagtgggccggctcctgctggtacgagctgcggtacctggatccgacc
aacggcgaccgcttcgtcgacccggaggccgagcggtactggatgggcccacgcggcgag
ggcgactgcgggggcaccgacctgtacgtcggcggtgccgagcatgccgtactgcacctg
ctctatgcgcggttctggcacaaggtgctgtacgacctggggcacgtgtcgagcttcgag
ccgttccgcaagctgttcaaccagggctacatccaggcatacgcgtacaccgacgcgcgc
ggggcatacgtgccggcggaggaggtcgtcgagcgctccggcacctactacctgggtgat
gtccaggtcaaccgcgagtacggcaagatgggcaagtccctgcggaacgtggtgacaccg
gacgagatgtgcgccgcgtacggggcggacacgttccgggtgtacgagatgtcgatgggc
ccgctggaggtctcccgtccctgggagacgcgggcggtggtgggatcgttccggttcctg
cagcgggtctggcgggcgatcgtggacgaacgcagcggcgcgtcccgcgtggtggacgtg
ccggccgacgaggcgacccgccgactgctgcaccggatcgtggacggggtccggggcgac
atggaagcgatgcggttcaacaccacgatcgcgaagctgatcgagctgaccaacgcactg
acccggctgccggagacgccgcgtgaggtggccgaaccgctggtgctgatgctggcgccg
ttcgctccgcacgtcgccgaggagctgtggcgccggatgggccacgagacgtcgttgacc
tacgcggacttcccggtcgcggacccggccctgctggtggccgagtcggtgacctacccg
gtgcaggtcaacggcaaggtgcggggtcggatcgaggtgccggccgacgctgggcaggag
accgtccgcgcggcggcgctggaggcggtcgccgcctcgctggccggcaaggaaccccgc
aaggtcatcgtggtccccggccgaatggtctccgtggtggcctga

DBGET integrated database retrieval system