KEGG   Salinispora tropica: Strop_3320Help
Entry
Strop_3320        CDS       T00504                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase E2 component
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
stp  Salinispora tropica
Pathway
stp00020  Citrate cycle (TCA cycle)
stp00310  Lysine degradation
stp01100  Metabolic pathways
stp01110  Biosynthesis of secondary metabolites
stp01120  Microbial metabolism in diverse environments
stp01130  Biosynthesis of antibiotics
stp01200  Carbon metabolism
Module
stp_M00009  Citrate cycle (TCA cycle, Krebs cycle)
stp_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:stp00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Strop_3320
  Amino acid metabolism
   00310 Lysine degradation
    Strop_3320
Enzymes [BR:stp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Strop_3320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H TonB_N Trypan_PARP RnfC_N
Motif
Other DBs
NCBI-ProteinID: ABP55754
UniProt: A4XA14
Position
3808749..3810578
Genome map
AA seq 609 aa AA seqDB search
MPVSVTMPRLGESVTEGTVTRWLKQEGDTVEVDEPLLEVSTDKVDTEIPSPAAGVLTRIV
VGEDETAEVGSELATIGDEASGDNGATGGGEAESRQSAPEPTAAAEGTGPEPEQEQEQEQ
PAPAPSGEGNPVTMPALGESVTEGTVTRWLKQVGDTVEVDEPLLEVSTDKVDTEIPSPVA
GTVLEITVAEDETADVGATLAVVGTAGAAAKPEPEAKPKPEAKPKPEAKPEPEAKPEPEA
KPEPEAKPEPKVTEPTPGASYNEPAAETESASDPAKAEQAAAPSAPASRPATTGGTENAG
YVTPLVRKLAGEHGVDLSTINGTGVGGRIRKQDVLDAAEQARAAKAAPAPAAQPAAPAAK
PAARPTPSSKRGTTEKLPRIRATIAKRMHESLHEMAQLTTVVEVDVTRIAKLRAQAKDAF
QQRHGVKLSFLPFFAQAAVEALQAYPIVNAQMDLTAGKITYPEAEHLGVAVDTERGLMVP
VIHNAGDLNLGGIAKRVADLAERTRTNKISPDELAGATFTLTNTGSRGALFDTPIVPSPQ
SAMLGTGAVVKRPVVVNDPDLGEVVAVRSMIYLALSYDHRLIDGADAARFLGTIKERLEA
GNFEAELGR
NT seq 1830 nt NT seq  +upstreamnt  +downstreamnt
atgccggtatcggtcaccatgccccggctcggtgagagcgtcaccgagggcaccgtcacg
cgctggctcaagcaggagggcgacaccgtcgaggtcgacgagccgctgctcgaggtgtcg
accgacaaggtggacaccgagatcccgtcccccgcggccggcgtgctgacccgcatcgtg
gtcggcgaggacgagaccgccgaggtcggcagcgagctggcgacgatcggcgatgaggcg
tcgggcgacaacggggcgacgggcggcggcgaggccgagtcgcggcagtcggcgcccgag
cccaccgccgccgccgagggcacgggcccggagccggagcaggagcaggagcaggagcag
ccggctcctgcgccgtcgggcgagggcaacccggtgacgatgccggcgctcggcgagagc
gtcaccgagggcacggtcacccgctggctcaagcaggtcggcgacaccgtcgaggtcgac
gagccgctgctcgaggtgtcgaccgacaaggtggacaccgagatcccctcgccggtcgcc
gggaccgtcctggagatcaccgtggcggaggacgagaccgccgatgtcggtgcgacgctg
gcggtcgtcggcacggccggtgccgcggcgaagcccgagcccgaggcgaagcccaagccc
gaggcgaagcccaagcccgaggcgaagcccgagcccgaggcgaagcccgagcccgaggcg
aagcccgagcccgaggcgaagcccgagccgaaggtcaccgaaccgaccccgggcgcctcc
tacaacgagccggcggccgagaccgagagcgcctccgacccggcgaaggcagagcaggcc
gccgccccctcggcgcccgcctcccggccggcgacgaccggcggtacggagaacgccggc
tacgtcaccccactggtccgcaagctcgccggcgagcacggggttgacctctccacgatc
aacggcaccggcgttggtggccggatccgcaagcaggatgtgctcgacgcggccgagcag
gcccgcgccgccaaggcggctccggccccggcggcgcagcccgccgcccccgcggcgaag
cctgctgcccggcccacgcccagcagcaagcggggtaccaccgagaagctgccacggatc
cgcgcgaccatcgcgaagcggatgcacgagtcgctgcacgagatggcgcagctcaccacc
gtggtcgaggttgacgtcacccggatcgccaagctgcgggcgcaggcgaaggacgccttc
cagcagcggcacggcgtaaagctgtccttcctgccgttcttcgcccaggcggccgtcgag
gcgttgcaggcctacccgatcgtcaacgcccagatggacctgacggcggggaagatcacc
tacccggaggcggagcacctcggcgtcgccgtggacaccgagcgcggcctgatggtgccg
gtcatccacaacgccggcgacctcaacctgggtggcatcgccaagcgggtcgccgacctc
gccgagcgcacccgcaccaacaagatcagcccggatgagctcgctggtgcgacgttcacg
ctgaccaacaccggcagccggggtgccctcttcgacaccccgatcgtgccgtcgccgcag
tcggcgatgctcggcacgggtgccgtggtcaagcgcccggtcgtggtcaacgaccccgac
ctgggtgaggtcgtggccgtccggtcgatgatctacctggccctctcctacgaccaccga
ctgatcgacggtgcggacgcggcccgcttcctgggcacgatcaaggagcggctggaagcc
ggcaacttcgaggccgaactgggccggtaa

DBGET integrated database retrieval system