KEGG   Salinispora tropica: Strop_3375Help
Entry
Strop_3375        CDS       T00504                                 

Definition
(GenBank) glutamyl-tRNA synthetase
  KO
K01885  glutamyl-tRNA synthetase [EC:6.1.1.17]
Organism
stp  Salinispora tropica
Pathway
stp00860  Porphyrin and chlorophyll metabolism
stp00970  Aminoacyl-tRNA biosynthesis
stp01100  Metabolic pathways
stp01110  Biosynthesis of secondary metabolites
stp01120  Microbial metabolism in diverse environments
Module
stp_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:stp00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Strop_3375
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Strop_3375
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:stp01007]
    Strop_3375
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:stp03016]
    Strop_3375
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:stp02048]
    Strop_3375
Enzymes [BR:stp01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.17  glutamate---tRNA ligase
     Strop_3375
Amino acid related enzymes [BR:stp01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   Strop_3375
Transfer RNA biogenesis [BR:stp03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    Strop_3375
 Prokaryotic Type
   Other AARSs
    Strop_3375
Prokaryotic defense system [BR:stp02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   Type II TA system related factors
    Strop_3375
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1c
Motif
Other DBs
NCBI-ProteinID: ABP55808
UniProt: A4XA62
Position
3872610..3874007
Genome map
AA seq 465 aa AA seqDB search
MRFAPSPTGMFHVGGARSALQNWIFAKQQGGVFVLRVEDTDAARNKPEWTEGILAALEWI
GIARGSYEGPYFQSSYATEHRAAASRLHEGGRAYYCDCTREVVQARTGSPHTGYDGFCRD
RNLGPGAGRALRFRTPDEGATVVVDLIRGEPTFDNRLIEDFVIARSDGSPVFLLANVVDD
MTMGITHVIRAEEHLPNTPKQQLLWDALGVKPPVWAHVPVVVNEKRQKLSKRRDKVALEA
YRDEGYLADAMCNYLMLLGWAPSGDREIVPWPVIEEEFRLEEVNPSSAFFDEKKLRAFNG
EYIRALPIAEFIAGCQPWLTGTATIAPPPWQPDEFDAEAFAAVAPLAQTRIAVLSEIVPN
VDFLFLDSPLIDEGAWAKAMKEGAGDLLDAVIAAFTALPSWDADSTKSTLEAVGAEHGLK
LGKAQAPVRVAVTGRRVGLPLFESLEVLGRERTLTRLRAARLRLP
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
gtgcgcttcgccccctccccgaccggaatgttccacgtcggcggtgcccgctctgccctg
cagaactggatcttcgccaagcagcagggcggggtgttcgtactccgggtcgaggacacg
gacgcggcccgcaacaagcccgagtggaccgagggaatcctggcggcgctggagtggatc
ggcatcgcgcgcggtagctacgaagggccctacttccagtcctcgtacgcgaccgagcac
cgcgccgccgccagccggctacacgagggcgggcgcgcgtactactgcgactgcacccgt
gaggtggtgcaggcccgtaccggctcgccacacaccggctacgacggcttctgccgggac
cggaacctggggccgggtgccggccgcgccctacgcttccggaccccggacgagggtgcg
accgtggtggtcgacctgatccgcggtgagcccaccttcgacaatcggctgatcgaggac
ttcgtgatcgcccgaagcgacggctcaccggtcttcctgctcgccaacgtggttgacgac
atgacgatggggatcacccacgtcatccgggccgaggagcacctacccaacaccccgaag
caacagctgctctgggacgcactcggcgtcaagccaccggtctgggcgcacgtcccggtc
gtcgtcaacgagaagcggcagaagctgtccaagcgccgcgacaaggtcgccctggaggcg
taccgcgacgagggctatctggccgacgcgatgtgcaactacctgatgctgctcggttgg
gccccgtccggcgaccgggagatcgtgccctggccggtcatcgaggaggagttccgactg
gaggaggtgaacccctcctcggccttcttcgacgagaagaagctacgcgcgttcaacggt
gagtacatccgagcgctgccgatcgccgagttcatcgcgggatgccagccgtggttgacc
ggtaccgcgacgatcgcacctccgccgtggcagccggacgagttcgacgccgaggcgttc
gcggcggtggcaccgctggcacagacccgcatcgccgtcctcagcgagatcgtgcccaac
gtggacttcctcttcctcgactcgccgctgatcgacgagggagcgtgggccaaggcgatg
aaggagggcgccggcgacctgctcgacgcggtgatcgccgccttcaccgcgctgccttcg
tgggacgcggactcaaccaagtcgacactggaggcagtcggtgcggagcacggcctgaag
ctgggcaaggctcaggcacccgtccgggtagcggtgaccggccgccgggtcggtctcccc
ctcttcgagtccctcgaggtcctgggccgcgagcgcaccctgacccgcctacgggctgcc
cgcctccgtctcccctga

DBGET integrated database retrieval system