KEGG   Salinispora tropica: Strop_3813Help
Entry
Strop_3813        CDS       T00504                                 

Definition
(GenBank) succinyl-CoA synthetase (ADP-forming) beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
stp  Salinispora tropica
Pathway
stp00020  Citrate cycle (TCA cycle)
stp00640  Propanoate metabolism
stp00660  C5-Branched dibasic acid metabolism
stp01100  Metabolic pathways
stp01110  Biosynthesis of secondary metabolites
stp01120  Microbial metabolism in diverse environments
stp01130  Biosynthesis of antibiotics
stp01200  Carbon metabolism
Module
stp_M00009  Citrate cycle (TCA cycle, Krebs cycle)
stp_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:stp00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Strop_3813
   00640 Propanoate metabolism
    Strop_3813
   00660 C5-Branched dibasic acid metabolism
    Strop_3813
Enzymes [BR:stp01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Strop_3813
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A CPSase_L_D2
Motif
Other DBs
NCBI-ProteinID: ABP56244
UniProt: A4XBE5
Position
complement(4367854..4369032)
Genome map
AA seq 392 aa AA seqDB search
MDLYEYQGRDLFERHGLPVLAGGVATTPEEARAIAERLGGRVVVKAQVKVGGRGKAGGVK
LTEGAEETVARATDILGMDIKGHTVHKVMITVTADVAEEYYFSYLLDRANRTFLCIASVA
GGMDIEQVAAETPEKVVKEPIDANTGVDVATARRIVTQAGFPAEVADQTVEIAVDLWKAF
VAEDATLVEVNPLAKTAEGGLLLLDAKVSLDENAAFRHPDHEALVDQAAVDPLEQAAKEK
DLNYVKLDGEVGIIGNGAGLVMSTLDVVAYAGERHGGVKPANFLDIGGGASAAVMANGLE
IVLSDPAVKSVFVNVFGGITACDAVANGIVQALALLEQRGEKVTRPLVVRLDGNNAEAGR
AILDGANNPLIQRVDTMDGAAERAAELAAAGV
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
gtggacctgtacgagtaccaggggcgggacctgttcgagcggcatgggttgcccgtgctc
gccggcggcgtcgccacgaccccggaggaggcccgcgcgatcgccgaacgcctcggcggt
cgggtggtcgtcaaggcgcaggtgaaggtcggcggccggggcaaggccggcggggtgaag
ctgaccgagggcgcggaggagacggtggcccgggccaccgacatcctcggtatggacatc
aaggggcacaccgtccataaggtcatgatcacggtgaccgcggacgtggccgaggagtac
tacttctcctacctgctggaccgggcgaatcgcaccttcctctgcatcgccagtgtcgct
ggtgggatggacatcgagcaggtggccgccgagacgccggagaaggtcgtcaaggagccg
atcgacgcgaacaccggcgttgacgtggcgacggcccggcggatcgtcacgcaggccggg
ttcccggccgaggtcgccgaccagaccgtcgagatcgccgtggacctgtggaaggcgttc
gtcgccgaggacgcgacgctggttgaggtgaacccgctcgccaagaccgccgagggcggg
ctactcctgctcgatgccaaggtcagcctggatgagaacgccgcgttccgacacccggac
cacgaggcgctggttgaccaggccgcggtggaccccctggagcaggccgccaaggagaag
gacctcaactacgtcaagctcgacggtgaggttggcatcatcggcaacggtgctggactg
gttatgtcgaccctcgacgtggtcgcgtacgccggtgagcggcacggcggtgtgaagccg
gcgaacttcctcgacatcggtggcggtgcgagtgctgcggtcatggccaacggcctcgag
atcgtgctctccgatcccgcggtgaagagcgtcttcgtcaacgtcttcggtgggatcacc
gcctgtgacgcggtcgccaacggcatcgtgcaggcgctggccctgctcgagcagcggggc
gagaaggtcaccagaccgctggttgtccgcctcgacggcaacaacgcggaggccggtcgg
gcgattctcgacggcgcgaacaacccgctgatccagcgggtcgacacgatggatggtgcg
gccgagcgggccgccgagctggccgctgcgggggtctga

DBGET integrated database retrieval system