KEGG   Salinispora tropica: Strop_4297Help
Entry
Strop_4297        CDS       T00504                                 

Definition
(GenBank) dihydropteroate synthase
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
stp  Salinispora tropica
Pathway
stp00790  Folate biosynthesis
stp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:stp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Strop_4297
Enzymes [BR:stp01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     Strop_4297
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind
Motif
Other DBs
NCBI-ProteinID: ABP56725
UniProt: A4XCR8
Position
complement(4864988..4866448)
Genome map
AA seq 486 aa AA seqDB search
MKARPTIAMAELVSTLEISPRLARPMKMTPSTASRIGAILLAKKATTPSVLMPVGAGSAS
GVELRVVRAWAADDAASVSSMAITGNLPISRPAAPRRCSRHAWRERCSRCGCAAAVVTHR
EAVGPGRISRFGPPSRLRHLDARQFQSVRPPTVCDKPRRMTLIRLCRPTPCRRRSACQRP
RAGWRGGATEDRYGLLVTDLVQAAFPVVMGILNVTPDSFSDGGRYADLDAAIAHGVRLRG
DGAHLVDVGGESTRPGADRVAAETEAARVRPVIRELAAAGVPVSIDTTRARVAELALAAG
ARVVNDVSGGLADPDMARVVRDAGCPWVLMHWRGHSREMRELARYGDVVADVKAELAQRV
EAALAAGVAADRIVIDPGLGFAKTAAHNWELSARLPELLALGYPLLFAASRKSHLGALLA
ADGAPRPTEGREVATVATSVLAVAAGAWGVRVHDVQATADALAVWQATGSPRLAGASGTR
AKGEQR
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgaaggccaggccgacgatcgcgatggcggagctcgtcagcaccttggagatctcgccc
cggctcgcccgcccgatgaagatgacgcccagcacggccagcaggatcggggcgatcttg
ctggcgaagaaggcgacgacgccttcggtgttgatgccggtgggcgcgggctcggcgagc
ggtgtcgagctcagggtggtgagagcgtgggcggcggacgatgccgcctccgtcagctcg
atggcgatcactggaaacctccccatttcgcggccggcggcgccgcggcggtgcagtagg
catgcctggcgggaacggtgctcacggtgcggctgtgccgccgcggtcgtcacccaccgc
gaggcggtgggtcctgggcggatttcccgcttcggccctccctccaggcttcgccatctc
gatgctcggcaattccaaagcgtacggccacccactgtctgcgacaagccgcgaagaatg
accctgatccgactctgtcgtccgaccccgtgccggcgccgaagcgcatgtcagcgcccc
cgcgccgggtggcgcgggggcgccaccgaggaccggtacggtcttcttgtgaccgatctg
gtgcaggccgcgttcccggtggtgatgggcatcctgaacgtcacgccggactccttctcc
gacggcggacgctacgccgatctcgatgccgccatcgcacacggcgtgcggctgcgcggc
gacggtgcccacctggtggatgtgggtggcgagtccacccggcccggggcggaccgggtg
gccgccgagaccgaggcggcccgggtccggccggtgatccgcgagctggccgccgccggg
gtgccggtcagtatcgacaccacccgggcccgggtggccgagctggcgctcgccgccggg
gcgcgggtggtcaacgacgtctccggtgggctcgccgacccggatatggcccgggtggta
cgggatgccggctgcccctgggtgctcatgcactggcgcgggcactctcgcgagatgagg
gagctggcccgctacggcgacgtcgtcgccgacgtcaaggccgagctggcgcagcgggtt
gaagcggccctcgccgccggggtggcagccgaccgcatcgtcatcgacccggggctcggc
ttcgccaagaccgccgcccacaactgggagctgagcgcccgactgccggagctgctggcg
ctcggttacccgctgctcttcgccgccagccgtaagtctcacctgggcgcgctgctcgcc
gccgacggcgccccgcgaccgaccgagggccgggaggtcgccaccgtcgccaccagcgtg
ctcgcggtcgcggccggcgcctggggggtgcgggtgcacgacgtccaggccaccgccgac
gcgctggccgtctggcaggccaccgggtcaccccgactggccggcgcctccggcacccga
gccaagggagaacagcgttga

DBGET integrated database retrieval system