KEGG   Spirochaeta thermophila DSM 6578: Spith_0054Help
Entry
Spith_0054        CDS       T02016                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
stq  Spirochaeta thermophila DSM 6578
Pathway
stq00260  Glycine, serine and threonine metabolism
stq00750  Vitamin B6 metabolism
stq01100  Metabolic pathways
stq01110  Biosynthesis of secondary metabolites
stq01120  Microbial metabolism in diverse environments
stq01230  Biosynthesis of amino acids
Module
stq_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:stq00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Spith_0054
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Spith_0054
Enzymes [BR:stq01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Spith_0054
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Thr_synth_N
Motif
Other DBs
NCBI-ProteinID: AEJ60341
UniProt: G0GBI2
Position
54720..56027
Genome map
AA seq 435 aa AA seqDB search
MRFVSTRNPKDVVSFEEAVFRGLAPDGGLYHPVERLDLASLYERLGPEKGFVDVSYEMVR
LLFGDEFSEEEAGRLVERAFPFSPVLRELTGSILLLELFHGPSCAFKDFGASFLASCMEV
FLSRREGRAVILTATSGDTGSAVAQAFHGRRHIDVVILYPSGRVSPLQEKQLTTLGGNVH
ALEVAGSFDDCQRMVKEAFLDRELRERCPLTSANSINLGRLVPQSFYYVWAYAQLKARGD
RPFFCVPSGNFGNLTAGVYAWWWGMPVRGFLAATNVNDVVPEYLSTGVFTPRSSVRTLSN
AMDVGNPSNFERLLALFEGDHRRMAAVIRGERVTDEETLDTIARYWREREVFLDPHTAVG
VKASERLLERERGVAPVVTLATAHPGKFLEVVEDALGIRPPLPPQLEEVLAKEKRAVKIP
NTLEALKAFLLDLWG
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgcgtttcgtgagcacgaggaatcccaaggacgtggtctcgttcgaagaggcggtgttc
cgggggcttgctccggacggagggctctaccatccggtggagcgtctggacctcgcctcc
ctctacgagcgtctcggtcccgagaagggcttcgtcgacgtttcgtacgagatggttcgc
ctcctcttcggcgatgagttctcagaggaggaggcgggccggctcgtggaacgggccttt
cccttctctcctgtgctgagggagctcaccggttcgatcctcctcctcgagctcttccat
gggccttcgtgcgccttcaaggacttcggcgcgagctttctcgcgagctgcatggaggtc
ttcctctcccggagggaggggcgggccgtgatcctcacggccacgtcgggggatacgggg
agtgcggtggcacaggccttccacgggcggcggcacatcgatgtggtgatcctctaccct
tcggggagggtgagtccgcttcaggagaagcagctcaccacactgggggggaacgtccat
gccctcgaggtggccggctcgttcgacgattgccagcggatggtgaaggaggccttcctc
gatcgggagctcagggagcggtgtcctctcacgagcgccaattccatcaacctggggagg
ctcgttccgcagtcgttctactacgtgtgggcctatgctcagctgaaggcgcgaggggat
aggcctttcttctgtgtcccgagcgggaacttcggcaatctcaccgccggggtgtatgcg
tggtggtgggggatgccggtgagagggtttctcgcggccaccaacgtgaacgacgtggtg
ccggagtacctttccaccggggtgttcacgccgcggtcgtcggtgaggacgctctcgaat
gccatggatgtgggcaatccgagcaatttcgagcggctcctcgccctcttcgagggggat
caccgccggatggccgcggtgatacggggtgagcgggtgaccgacgaggagacgctcgat
accatcgcccggtactggcgggagcgtgaggtcttcctcgatcctcacacggcggtgggg
gtgaaggcatcggagcgtctcctggaacgggagaggggggtggcgccggtggtgacgctc
gccacggcgcatccgggcaagttcctcgaggtggtcgaggacgcgctggggatcaggcct
cccctccctccccagctcgaggaggtgctcgcgaaggagaagcgggccgtgaagatcccc
aacaccctggaggcgctcaaggccttcctcctcgatctgtgggggtag

DBGET integrated database retrieval system