KEGG   Spirochaeta thermophila DSM 6578: Spith_1921Help
Entry
Spith_1921        CDS       T02016                                 

Definition
(GenBank) Tryptophan synthase beta chain
  KO
K06001  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
stq  Spirochaeta thermophila DSM 6578
Pathway
stq00260  Glycine, serine and threonine metabolism
stq00400  Phenylalanine, tyrosine and tryptophan biosynthesis
stq01100  Metabolic pathways
stq01110  Biosynthesis of secondary metabolites
stq01130  Biosynthesis of antibiotics
stq01230  Biosynthesis of amino acids
Module
stq_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:stq00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Spith_1921
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Spith_1921
Enzymes [BR:stq01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Spith_1921
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: AEJ62179
UniProt: G0GDP9
Position
complement(2150825..2152177)
Genome map
AA seq 450 aa AA seqDB search
MQRKILLSEKDLPSHWYNILADLPGGPLDPPLHPVTKQPLSPDELSALFPRALIEQEMSG
ERWIEIPEEVRKILALWRPTPLYRAYQLEQALETPARIYFKWEGASPPGSHKPNTSVAQA
YYNRKEGITRLTTETGAGQWGSSLAFAGRLFGMEVRVYMVKVSYEGKPYRRIMMETWGAE
CIPSPSPRTKVGKAILEKDPDSPGSLGIAISEAVEEAVEREDTHYALGSVLNHVLLHQTV
IGLECRKQLELASDYPDVVIGCVGGGSNFGGIALPFAYDKIHGKDVRLVAVEPSACPTLT
KGVYTYDYGDTGKMTPIVRMHTLGHDFVPPGIHAGGLRYHGMAPIVSRLVKEGVVEARAY
HQRAVFEAAVLFARTEGFIVAPETAHAIKACVDEALAAKEEGKERVILVNASGHGHFDMA
AYQQYFEGRLEDYEYPEEKIREALSALPQV
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgcaaagaaaaatcctgctcagtgaaaaggatcttccctcgcactggtacaacatcctc
gcggacctgccgggtgggccgctcgacccgcccctccatccggtcacgaagcagccgctc
tcgccggatgagctctccgccctcttcccccgggccctcatcgaacaggagatgagcggc
gagcggtggatcgagattcccgaggaggtgcggaagatcctcgccctctggcggcccacg
ccgctctaccgggcctaccagcttgaacaggccctcgagaccccggctcgtatctacttc
aagtgggagggtgcctctcctccgggttcccacaagcccaatacctcggtggcccaggcc
tactacaacaggaaggaagggatcaccaggctcaccacggagacgggggcgggccagtgg
gggagcagcctcgccttcgcgggcaggctcttcgggatggaggtgcgggtctacatggtg
aaggtgagctacgagggcaagccctacaggcgcatcatgatggagacgtggggcgccgag
tgcatacccagtccctcaccccgcaccaaggtgggcaaggccatcctcgagaaggatccc
gactcgcccggttccctcggtatcgccataagcgaggccgtggaggaggcggtggaacgg
gaggacacccactacgccctcggttcggtgctcaaccacgtgctgctccaccagaccgtg
atcggcctcgagtgcaggaagcagctcgaactcgcgagtgactatcccgatgtggtcata
ggctgtgtgggtgggggatcgaacttcgggggtatcgcccttcccttcgcctacgacaag
atccatgggaaggacgtacgcctcgtggcggtggagccgtcggcgtgtcccaccctcacc
aaaggggtctatacgtacgactacggcgacacggggaagatgacccccatcgtgaggatg
cacaccctggggcacgacttcgtcccgccgggcatccatgcaggaggcctgcggtatcac
ggcatggcgcccatcgtctcacgtctggtgaaggagggggtggtcgaggcccgtgcctac
catcagagggcggtcttcgaggccgcggtcctcttcgcccgcaccgaggggttcatcgtg
gcgcccgagacggcccatgcgatcaaggcctgcgtggacgaggccctcgcggcgaaggaa
gaagggaaggagcgggtcatcctggtgaacgcatcgggtcacgggcacttcgacatggcg
gcctaccagcagtacttcgagggcaggctcgaggattacgagtatcccgaggagaagatc
agggaggcgctctcggcgctcccccaggtctga

DBGET integrated database retrieval system