KEGG   Sebaldella termitidis: Sterm_0577Help
Entry
Sterm_0577        CDS       T01123                                 

Definition
(GenBank) Aldose 1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
str  Sebaldella termitidis
Pathway
str00010  Glycolysis / Gluconeogenesis
str00052  Galactose metabolism
str01100  Metabolic pathways
str01110  Biosynthesis of secondary metabolites
str01120  Microbial metabolism in diverse environments
str01130  Biosynthesis of antibiotics
Module
str_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:str00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sterm_0577
   00052 Galactose metabolism
    Sterm_0577
Enzymes [BR:str01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     Sterm_0577
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: ACZ07450
UniProt: D1ANX6
Position
complement(629835..630827)
Genome map
AA seq 330 aa AA seqDB search
MELRIFELKSPKLKIEILNLGGIIRKIETPDKNGIFENVVLGYENIEEYYKNPDYLGSLI
GRTSGRIQNGEFILNDRKYTLAKNDGNNNLHGGSKGFNKVFWEVLSYTESGILLSYTSGD
GEEGYPGTAEIEVEYRIENEDELVVEYKAVSDKDTLLDLTQHSYFNLSGNYKRTSLEHDL
KIPSDSFVEIDESGMITDVIKNVKGSPFDFNTIKNIGKNIDPEDKQIQNASGAYDHAFIL
NNSQNIELYDKISGRKMTVNTDAPAVIFYNSTKMGENMLLTGGINSRRFLGACLETQHIP
NAVNFSGFKVPVLKKNDTYRSKTVFKFSIM
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atggaattaagaatttttgaactaaaaagtccgaaattgaaaattgaaatactaaatttg
ggcggaatcatcagaaaaatcgaaactccggataaaaacggaatttttgagaatgtagta
ctgggatatgaaaacatagaagaatactataaaaatcctgattatctcggctctttaata
ggacgtacatcaggcagaatacaaaacggggaatttatacttaatgacaggaagtatact
cttgccaaaaatgacgggaataataatcttcacggcggaagcaaaggatttaacaaggtt
ttctgggaagttctcagctataccgagagcggtattcttttatcttacacaagcggggat
ggagaagaaggatatccgggaaccgcggagattgaagtagaataccgtatcgaaaacgaa
gatgagctggtagtggaatataaagcagtttctgataaagacactctgcttgatctcaca
cagcactcatatttcaatctcagcggaaattataaaagaacttcgctggagcatgatctg
aaaattccttctgattcctttgtagaaatcgatgaaagcggaatgattaccgatgttata
aaaaatgtaaaaggaagtccttttgattttaatactatcaaaaatataggaaaaaatatt
gatcccgaggacaaacagattcagaatgcttccggggcgtatgaccacgcctttatatta
aacaattcccaaaatatagaattatatgataaaataagtggtagaaaaatgactgtaaat
actgatgctccggctgtaatattctataactccactaaaatgggagaaaatatgttgctt
acaggcggtattaattcccggcgtttcctcggagcctgtctggaaacacagcacattccc
aatgcggttaacttcagcggattcaaagtacctgtactgaaaaaaaatgatacttacaga
agtaaaactgttttcaaattcagcatcatgtaa

DBGET integrated database retrieval system