KEGG   Sebaldella termitidis: Sterm_0998Help
Entry
Sterm_0998        CDS       T01123                                 

Definition
(GenBank) Phosphoglycerate mutase
  KO
K02226  alpha-ribazole phosphatase [EC:3.1.3.73]
Organism
str  Sebaldella termitidis
Pathway
str00860  Porphyrin and chlorophyll metabolism
str01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:str00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Sterm_0998
Enzymes [BR:str01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.73  adenosylcobalamin/alpha-ribazole phosphatase
     Sterm_0998
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1 Endonuc-PvuII TEX19
Motif
Other DBs
NCBI-ProteinID: ACZ07866
UniProt: D1AFI1
Position
complement(1086398..1087003)
Genome map
AA seq 201 aa AA seqDB search
MNKNTEFIFIRHGITELNVKKVYFGQLDPALINEGIQQIQNTKKNLINENISLFYSSDLK
RCTESAKIINESLNLDIIEKEGFRELNFGIFEGISHEELMNKYPEEADIFFKNWETYRIP
GGESIHDFMMRAVNEIEEIKKACKGERILITTHSGVIQSVLSYYFTGNLEAYWKFRFNHG
SMTKLCFDSSDFAFLEYVNRI
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaaatacggaatttatatttatacgtcacggtattacagaattgaatgtaaaa
aaggtatatttcggacagcttgacccggcgttaattaatgaaggaattcagcagattcaa
aatacaaaaaaaaatcttatcaatgaaaatatcagtctgttttattccagtgatctgaaa
agatgtactgaatctgcaaaaatcataaatgaatctcttaatcttgatattatagaaaaa
gaaggatttcgtgaattaaatttcggaatttttgaaggaataagccatgaagagttaatg
aataaatatccagaagaagccgatattttttttaaaaactgggaaacataccgtattccc
ggcggtgagagtattcatgattttatgatgagagctgtaaatgaaattgaggaaataaaa
aaagcctgtaaaggagaaagaattcttataacaacacattcaggtgttatacagtcagtt
ctttcatattatttcacaggaaaccttgaggcttactggaaattcagatttaatcacggc
tctatgactaagctgtgttttgatagttctgattttgcttttttggaatatgttaacaga
atataa

DBGET integrated database retrieval system