KEGG   Sebaldella termitidis: Sterm_1122Help
Entry
Sterm_1122        CDS       T01123                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
str  Sebaldella termitidis
Pathway
str00010  Glycolysis / Gluconeogenesis
str00051  Fructose and mannose metabolism
str00562  Inositol phosphate metabolism
str01100  Metabolic pathways
str01110  Biosynthesis of secondary metabolites
str01120  Microbial metabolism in diverse environments
str01130  Biosynthesis of antibiotics
str01200  Carbon metabolism
str01230  Biosynthesis of amino acids
Module
str_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
str_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:str00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sterm_1122
   00051 Fructose and mannose metabolism
    Sterm_1122
   00562 Inositol phosphate metabolism
    Sterm_1122
Enzymes [BR:str01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Sterm_1122
Exosome [BR:str04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Sterm_1122
  Exosomal proteins of bladder cancer cells
   Sterm_1122
  Exosomal proteins of melanoma cells
   Sterm_1122
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ACZ07990
UniProt: D1AFV5
Position
1228730..1229485
Genome map
AA seq 251 aa AA seqDB search
MRKIIVAGNWKMNKTNKEAVSFLSELKGLVGGINEVETVIGAPFTALSDAVKEVEGSNVK
IAAQNMNPNESGAYTGEISPLMLKELGVEYVILGHSERREYYGENNEFINAKVKAALNHG
LKPILCVGEKLEEREAGKTEDVVANHVQGGLDGITAEEMKNVVIAYEPVWAIGTGKTATP
EQAELVHNFIRLLLIDLYGKEIGEGVTIQYGGSMKPDNAKELISQKNIDGGLIGGASLEA
KSFSEIVKAAL
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgagaaagataattgtagcaggaaactggaagatgaacaaaacaaataaagaggcagta
agctttttatcagaattaaaaggtctagtaggcgggataaatgaggtagaaactgtaata
ggagcaccatttacagctttatcagatgcggtgaaagaagtagaaggttcaaatgtaaaa
atcgctgcacaaaatatgaatccaaatgaaagcggtgcatatacaggagaaatatcacct
cttatgctgaaagaattaggtgtggaatatgtaatactggggcattctgaaagaagagag
tattatggtgaaaataacgaattcataaatgcaaaagtaaaagctgctctgaatcatggg
ttaaagcctattttatgtgtcggggaaaaactggaagagagagaagcagggaagacagaa
gatgtagtggctaatcatgtgcagggtggacttgacggaataactgcagaagaaatgaaa
aatgtggtaatagcttatgagcctgtatgggcaataggaacaggaaaaacagctacacct
gagcaggctgaacttgttcataacttcataagattgttattaatagatttatacggaaaa
gaaatcggggaaggtgtaactatccaatacggaggttcaatgaaacctgataatgcaaaa
gaattaatttcacaaaagaatatagacggcggactaattggaggagcaagcttagaagca
aaaagtttttctgaaatagtaaaagcagcgttataa

DBGET integrated database retrieval system